Speisekarte Italiener Eisenhüttenstadt, Seealpsee Wanderung Wetter, Lavazza Kaffeebohnen Proben, Low Carb Pudding Dr Oetker, Prüfungsergebnisse Ihk Dauer, Lost Places Doku N24, Standesamt Cuxhaven Corona, Bad Iburg Gartenschaugelände, Beförderung Reservisten Stabsfeldwebel, " />

$(document).ready(function() { "messageViewOptions" : "1111110111111111111110111110100101011101" "event" : "MessagesWidgetEditAnswerForm", }, ] "disableKudosForAnonUser" : "false", "actions" : [ "event" : "ProductMessageEdit", "action" : "pulsate" }, "action" : "pulsate" $(this).addClass('active') { ;(function($) { "kudosable" : "true", "actions" : [ } "dialogContentCssClass" : "lia-panel-dialog-content", ], Die Anzeige aktualisiert sich in der Regel nach spätestens 24 Stunden. })(LITHIUM.jQuery); "actions" : [ if ( neededkeys[count] == key ) { { "event" : "AcceptSolutionAction", "action" : "pulsate" ', 'ajax'); "event" : "removeThreadUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" Kunden-/Vertragsnummer. "actions" : [ { { ] } { { { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } ] ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ $(event.data.selector).addClass('cssmenu-open') }, "action" : "rerender" "entity" : "2076165", "actions" : [ "actions" : [ "disableKudosForAnonUser" : "false", }, { "action" : "rerender" { { "event" : "MessagesWidgetAnswerForm", } LITHIUM.AjaxSupport.ComponentEvents.set({ { "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "expandMessage", ] }, }, ] "action" : "rerender" "event" : "kudoEntity", "initiatorDataMatcher" : "data-lia-kudos-id" { } }(LITHIUM.jQuery)); "action" : "pulsate" LITHIUM.Dialog.options['1645504963'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, }, "action" : "rerender" { } ] { }, $('#community-menu-toggle').click(function() { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); $('#vodafone-community-header').toggle(); "disableLabelLinks" : "false", //}); "actions" : [ "actions" : [ "event" : "deleteMessage", "actions" : [ "action" : "rerender" "event" : "deleteMessage", "actions" : [ "actions" : [ "event" : "QuickReply", { "useTruncatedSubject" : "true", "useSimpleView" : "false", "context" : "envParam:quiltName", }, { "action" : "rerender" ] "action" : "rerender" if ( watching ) { "componentId" : "forums.widget.message-view", { { "context" : "", { "disallowZeroCount" : "false", "context" : "", }, }, { element.siblings('li').find('li').removeClass('active'); { // We're good so far. Widerruf meines Vertrags. "context" : "", "action" : "rerender" ', 'ajax'); "actions" : [ Sie müssen dazu nur einige, wenige Angaben machen und können die Vorlage dann entsprechend an Ihren Vertragspartner senden. "context" : "", "displayStyle" : "horizontal", if ( !watching ) { }, LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "kudosLinksDisabled" : "false", "action" : "rerender" CookieManager = { { ', 'ajax'); { }, "actions" : [ "selector" : "#kudosButtonV2_1", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1eda7073bb4843","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1eda7073bb4843_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/2001/thread-id/227579&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XYhEys9KfKWN8IesAue2lmQf1wUzStZzCinsJll8KkI. "event" : "expandMessage", { "event" : "MessagesWidgetMessageEdit", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); $(document).ready(function() { "action" : "pulsate" "displayStyle" : "horizontal", "actions" : [ "context" : "", "action" : "rerender" "action" : "rerender" } } { { "context" : "envParam:quiltName", "kudosable" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"nvnXtqZsX9ihJGfs829ib656wsTLNXPUQBcCghhz6rY. "componentId" : "forums.widget.message-view", "event" : "expandMessage", $(document).keydown(function(e) { "eventActions" : [ }, "}); "initiatorDataMatcher" : "data-lia-kudos-id" { { ] LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, } } { "action" : "pulsate" var count = 0; { }); "useSubjectIcons" : "true", { "context" : "", "action" : "pulsate" "action" : "rerender" { })(LITHIUM.jQuery); { "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductMessageEdit", } LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "lia-deleted-state", }); { ;(function($) { { "activecastFullscreen" : false, "action" : "addClassName" "displayStyle" : "horizontal", }, ] "componentId" : "forums.widget.message-view", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"h-PX4VgD8F3UhnTKGYpa1J4xidkwEF-_4VycouvjSNo. { "disableLabelLinks" : "false", "action" : "rerender" }, "event" : "expandMessage", "event" : "ProductMessageEdit", } "useCountToKudo" : "false", "componentId" : "kudos.widget.button", ', 'ajax'); }); "truncateBody" : "true", lithstudio: [], } { } }); ], ] setCookie: function(cookieName, cookieValue) { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $('.lia-autocomplete-footer').append(ctaHTML); $(this).next().toggle(); "eventActions" : [ "event" : "approveMessage", ] "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" Widerruf SEPA Mandat. } { }); { "}); "action" : "rerender" ] { { "parameters" : { } { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", // We made it! } count++; { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2077214,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); }, ] ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ ] "quiltName" : "ForumMessage", "action" : "rerender" Wenn Sie einen bestehenden Vertrag bei Vodafone kündigen, meldet sich Vodafone oft telefonisch, um Sie zu einer Vertragsänderung statt Vertragsauflösung zu überreden. // enable redirect to login page when "logmein" is typed into the void =) LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "includeRepliesModerationState" : "false", "selector" : "#messageview_0", "event" : "ProductMessageEdit", "action" : "rerender" } "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1eda7075490ada', 'disableAutoComplete', '#ajaxfeedback_1eda7073bb4843_0', 'LITHIUM:ajaxError', {}, '4Xxn4o4xZcQWXzq6KcDYh2HGpAVxtmo6I9NYF7jq0ik. if (element.hasClass('active')) { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "quiltName" : "ForumMessage", } { }, ] "context" : "envParam:entity", { "useSubjectIcons" : "true", "event" : "ProductMessageEdit", "actions" : [ "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] }, } { "action" : "rerender" { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ], }, "event" : "editProductMessage", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "forceSearchRequestParameterForBlurbBuilder" : "false", } } { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iBZoymCwAs-_Sl24rqnYN3W63kWRQ_VWFkbwZDOkF60. "actions" : [ "context" : "envParam:feedbackData", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "disallowZeroCount" : "false", "event" : "ProductMessageEdit", "action" : "rerender" "actions" : [ $('div[class*="-menu-btn"]').removeClass('active'); LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '4FW-V4pshbjqjNU1JZ_lODptyuGHBdnCJB8nhpbTSoE. "event" : "editProductMessage", { "quiltName" : "ForumMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W8HG_ShH22NPI-NfxL6oDtviTlPcRdwnfDs6GABvHjE. "action" : "rerender" "action" : "rerender" "actions" : [ "event" : "unapproveMessage", "action" : "rerender" "actions" : [ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); { "event" : "unapproveMessage", "event" : "editProductMessage", watching = false; }, // Set start to true only if the first key in the sequence is pressed "quiltName" : "ForumMessage", "actions" : [ "context" : "", } { { "actions" : [ { "action" : "rerender" ] { "action" : "addClassName" "event" : "ProductAnswer", Checke jetzt die gigaschnellen Internet- und Telefon-Angebote für zuhause und unterwegs von Vodafone und surf mit GigaSpeed über Kabel, DSL oder LTE. "message" : "2076467", "action" : "rerender" }, var key = e.keyCode; ], { { "selector" : "#messageview_1", { }, "action" : "rerender" }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Tlgbg-Cl6G1pZMlnNcc96UThPcBN2ugbUsYIhYcoFwo. "context" : "", element.find('li').removeClass('active'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ] "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableKudosForAnonUser" : "false", Du hast ebenfalls bei Vodafone geshoppt? { } "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "context" : "", Dies habe ich nun online beim Retourenportal gemacht sowie telefonisch. "action" : "rerender" "revokeMode" : "true", { "displayStyle" : "horizontal", "event" : "RevokeSolutionAction", "action" : "rerender" } Es wurde mir gesagt, dass man mir eine Email zu diesem Auftrag zuschicken würde. ] // Oops, not the right sequence, lets restart from the top. } "actions" : [ ;(function($) { } ctaHTML += "Lösung noch nicht gefunden? "useCountToKudo" : "false", "event" : "markAsSpamWithoutRedirect", }, }); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2075990,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.

Speisekarte Italiener Eisenhüttenstadt, Seealpsee Wanderung Wetter, Lavazza Kaffeebohnen Proben, Low Carb Pudding Dr Oetker, Prüfungsergebnisse Ihk Dauer, Lost Places Doku N24, Standesamt Cuxhaven Corona, Bad Iburg Gartenschaugelände, Beförderung Reservisten Stabsfeldwebel,