Motorrad Rücklicht Mit Rückstrahler, Grundstück Von Gemeinde Kaufen, Wandern Mit Kindern Allgäu, Servus Tv Deutschland Mediathek, Kita Bremen - Mitte, Finanzamt Fordert Steuererklärung Für 7 Jahre, Lufthansa Meilen Einlösen Tabelle, Wie Habt Ihr Eure Schwangerschaft Bemerkt, Personal Trainer Werden Tipps, Parkhaus Köln Neumarkt, " />

"action" : "rerender" "action" : "rerender" { "componentId" : "kudos.widget.button", "event" : "unapproveMessage", { { }, "event" : "QuickReply", "action" : "rerender" ] ] "action" : "rerender" $(document).ready(function(){ }, })(LITHIUM.jQuery); "context" : "", // Reset the conditions so that someone can do it all again. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] }, } lithstudio: [], ] "context" : "envParam:quiltName,message", "eventActions" : [ }, { } "event" : "kudoEntity", { "event" : "removeMessageUserEmailSubscription", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } "actions" : [ { ] { "linkDisabled" : "false" "action" : "rerender" "action" : "rerender" } else { "context" : "", } "eventActions" : [ { "actions" : [ { ], ] $(document).keydown(function(e) { "context" : "envParam:quiltName,message", ] "selector" : "#kudosButtonV2_5", "context" : "envParam:entity", "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetEditCommentForm", "event" : "QuickReply", { "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ Vodafone TV. } { LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ "disableKudosForAnonUser" : "false", watching = false; "action" : "rerender" "event" : "MessagesWidgetEditAction", "actions" : [ }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2066434 .lia-rating-control-passive', '#form_3'); { ], } ] "context" : "", "disableKudosForAnonUser" : "false", "revokeMode" : "true", } "action" : "rerender" "context" : "", "action" : "addClassName" { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "action" : "rerender" "event" : "ProductAnswer", "event" : "addMessageUserEmailSubscription", { } "actions" : [ } Bist du sicher, dass du fortfahren möchtest? }); "quiltName" : "ForumMessage", "actions" : [ "actions" : [ "context" : "", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "displaySubject" : "true", ], "action" : "rerender" }, "context" : "", "truncateBodyRetainsHtml" : "false", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'psdZynxitTPHETJ-0wVFmQ7s1cc4wrkD6F33C-g2QXI. "actions" : [ "kudosable" : "true", "displaySubject" : "true", "entity" : "2065970", "actions" : [ "initiatorBinding" : true, "displayStyle" : "horizontal", "context" : "", "action" : "rerender" { } }, "initiatorBinding" : true, }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", "useSubjectIcons" : "true", "displaySubject" : "true", "context" : "", "event" : "deleteMessage", "action" : "addClassName" } }, { "action" : "rerender" }, { "context" : "envParam:quiltName,message", "kudosable" : "true", "event" : "MessagesWidgetCommentForm", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:quiltName", Vodafone is committed to attracting, developing and retaining the very best people by offering a motivating and inclusive workplace in which talent is truly recognised and rewarded. LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "event" : "deleteMessage", ;(function($) { "context" : "", "context" : "envParam:quiltName", { "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "event" : "MessagesWidgetMessageEdit", "entity" : "2065970", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); ], { ] "context" : "", { "actions" : [ LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); "context" : "", { "context" : "", }, } }, ;(function($) { } "action" : "rerender" } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "context" : "", "componentId" : "forums.widget.message-view", "event" : "removeThreadUserEmailSubscription", }); "context" : "", "action" : "rerender" { //resetMenu(); "actions" : [ "actions" : [ "context" : "", }, } { "action" : "pulsate" }, "event" : "markAsSpamWithoutRedirect", "context" : "", "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport.ComponentEvents.set({ { "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetAnswerForm", We understand the importance of data for the growth of your company and how it’s important to be data driven. // console.log('watching: ' + key); })(LITHIUM.jQuery); }, { "action" : "rerender" "event" : "MessagesWidgetCommentForm", } "actions" : [ $(this).next().toggle(); { { "actions" : [ } LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2066914,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "messageViewOptions" : "1111110111111111111110111110100101001101" } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_70ce840563054f","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_70ce840563054f_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JdIolaOf-aojPHUXOg4S_5cJRF1cPzh_UHvsnWs5_J4. } { "actions" : [ } "actions" : [ "context" : "envParam:quiltName,message", "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ ] "useTruncatedSubject" : "true", ;(function($) { ] "revokeMode" : "true", "actions" : [ "actions" : [ { }); "actions" : [ "event" : "removeMessageUserEmailSubscription", { { } { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" ] { "context" : "envParam:quiltName,message", { { "context" : "", ] "action" : "rerender" "action" : "rerender" }, "actions" : [ } "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ if(do_scroll == "true"){ "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "displayStyle" : "horizontal", ] "kudosLinksDisabled" : "false", { "dialogKey" : "dialogKey" "action" : "rerender" }, "event" : "MessagesWidgetMessageEdit", } else { "action" : "pulsate" }, "context" : "", "event" : "ProductAnswer", { "event" : "AcceptSolutionAction", "event" : "deleteMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetEditCommentForm", { "event" : "markAsSpamWithoutRedirect", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); ] ] watching = false; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g9S5axfYEpcna7dhAFikgXN9tEVprIWGOKbo1ttqvz0. }); "action" : "rerender" "componentId" : "forums.widget.message-view", { "context" : "", In the UK, Vodafone offers business mobile plans in addition to standard consumer mobile plans. LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "kudosLinksDisabled" : "false", { }, "action" : "rerender" { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { "action" : "rerender" }, Find out how we’re helping businesses of all sizes and sectors connect for a better future. "actions" : [ } }, }, { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "componentId" : "kudos.widget.button", // If watching, pay attention to key presses, looking for right sequence. "actions" : [ © 2021 Vodafone Limited. } "action" : "rerender" "truncateBodyRetainsHtml" : "false", { { "disableLinks" : "false", "action" : "rerender" }, "linkDisabled" : "false" "event" : "addMessageUserEmailSubscription", }, "action" : "rerender" '; return; }, "context" : "", "actions" : [ "context" : "", "useSimpleView" : "false", { "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#messageview_4", Vodafone for Business. ] { "disableLinks" : "false", "action" : "rerender" Die Variante 2 funktioniert übrigens auch in einem Privat-Tarif. { "parameters" : { { "actions" : [ { "action" : "rerender" "event" : "ProductAnswer", LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); // enable redirect to login page when "logmein" is typed into the void =) LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "context" : "", }, "context" : "envParam:selectedMessage", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] ] "action" : "rerender" }, { "context" : "envParam:selectedMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ic4bPvHUwEPZ1Y1qE_b-ZJJiWQ-AczJWzuKQ0UU10aA. LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); Nur der Wechsel in einen Business-Tarif reicht nicht aus. { "componentId" : "kudos.widget.button", "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "deleteMessage", { } "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ } { "context" : "envParam:quiltName", ] "actions" : [ ] "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); count++; ] ] "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Dxhu58D-hvqAx7elcShTjA_1G86indaBp_kT7dRxf5I. }, { { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "useTruncatedSubject" : "true", }, ] "context" : "envParam:quiltName,product,contextId,contextUrl", "useSimpleView" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); ;(function($) { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", "disallowZeroCount" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,product,contextId,contextUrl", { ] '; "event" : "MessagesWidgetEditCommentForm", Bist du sicher, dass du fortfahren möchtest? } { }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "ProductAnswer", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); }, "actions" : [ "action" : "pulsate" "initiatorBinding" : true, }, "action" : "rerender" } "action" : "rerender" "action" : "rerender" "parameters" : { Unified Communications and Collaboration solutions for multinational organisations. }, "displaySubject" : "true",

Motorrad Rücklicht Mit Rückstrahler, Grundstück Von Gemeinde Kaufen, Wandern Mit Kindern Allgäu, Servus Tv Deutschland Mediathek, Kita Bremen - Mitte, Finanzamt Fordert Steuererklärung Für 7 Jahre, Lufthansa Meilen Einlösen Tabelle, Wie Habt Ihr Eure Schwangerschaft Bemerkt, Personal Trainer Werden Tipps, Parkhaus Köln Neumarkt,