a').on('click', function(){ { "}); ', 'ajax'); "context" : "", "parameters" : { "event" : "ProductMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", { "event" : "ProductAnswerComment", "event" : "ProductAnswer", } { }, } { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ } "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, }, "event" : "approveMessage", { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { "actions" : [ "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1763611,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" "revokeMode" : "true", { { } } } "useSubjectIcons" : "true", }, "actions" : [ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" { { "componentId" : "kudos.widget.button", "action" : "rerender" return true; "action" : "pulsate" "useSubjectIcons" : "true", }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", "event" : "deleteMessage", "action" : "rerender" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); ] { ;(function($) { "event" : "ProductAnswer", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetCommentForm", })(LITHIUM.jQuery); "disableLabelLinks" : "false", "action" : "rerender" ] LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", ;(function($) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "event" : "ProductMessageEdit", "context" : "", }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2091090 .lia-rating-control-passive', '#form_0'); $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { o.innerHTML = "Page must be in a numeric format. { { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { "revokeMode" : "true", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetCommentForm", { disableInput(pagerId); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, "event" : "AcceptSolutionAction", "event" : "QuickReply", { "actions" : [ "event" : "removeThreadUserEmailSubscription", Gmail funktioniert nicht: Checke zunächst die Status-Übersicht Nicht immer muss es an Deinem Tun liegen, wenn der Google-Mailac­count ein­mal nicht wie gewohnt funk­tion­iert. "context" : "envParam:selectedMessage", "displayStyle" : "horizontal", "event" : "expandMessage", { ] "initiatorBinding" : true, ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.useTickets = false; "actions" : [ { } ] "action" : "rerender" "actions" : [ }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "quiltName" : "ForumMessage", "context" : "", } "context" : "envParam:selectedMessage", ] ] }); "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "MessagesWidgetEditAction", ] }, }, "context" : "", "componentId" : "kudos.widget.button", "truncateBodyRetainsHtml" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/7001/thread-id/95793","ajaxErrorEventName":"LITHIUM:ajaxError","token":"z7Tgg3vwp8-L9MoVvSa1jxfQGNgU8u6m6b3RAQ06Ras. "event" : "expandMessage", count++; "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_38cc7adf067d17","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/68876&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ;(function($) { "action" : "rerender" if (1 != val) { "action" : "addClassName" }); }, element.siblings('li').find('ul').slideUp(); "event" : "unapproveMessage", "actions" : [ { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1192,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk16AVxdYl0BVwBWXAdPegFcXX9TB1MKFHdPL1YNWW8bZApSB19dDAcaJUVDGVQQWA1NWw0MXgFHRxlcDFUOTW5NFlNJRW8bAFUPVg4HVEAbRlNBVV8AfwIbCFNQA1IMBw0EUABSDh5ACVQxRlZGewEUXBQDTkBcB2VSU1crVwtcEFhAcQtHRllmCkYPWmIDBVJGGRFfUShZBFBeB0ANRkFBQVdHGkRSUSANQ0YPEVJTCUUDGx5ACVQwTREOEFJVUwsDAQRUSVcBVgBIAgNbBk9bVV1UHgFTVAVRCVZWUQNdAxEYEA5VKFZWBytTRg8RAwJVB0QVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "action" : "rerender" }, LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ } "useTruncatedSubject" : "true", "actions" : [ }); "actions" : [ "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") }, ] "actions" : [ lithstudio: [], LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2095155,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "unapproveMessage", } }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, { { { } }, LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { "event" : "editProductMessage", "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message", }, "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "event" : "MessagesWidgetEditAction", LITHIUM.Dialog({ { { "useSimpleView" : "false", "action" : "rerender" }, ] "disallowZeroCount" : "false", }, { if ( Number(val) > 2 ) "context" : "", }, }, { "context" : "", } }); "initiatorDataMatcher" : "data-lia-message-uid" "event" : "ProductAnswerComment", "action" : "rerender" "action" : "rerender" { "actions" : [ "disableKudosForAnonUser" : "false", { { "context" : "envParam:quiltName,expandedQuiltName", }, ] }, "action" : "pulsate" "truncateBodyRetainsHtml" : "false", "action" : "rerender" }, "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName", } "displaySubject" : "true", { } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ { "context" : "", { { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "event" : "addThreadUserEmailSubscription", "actions" : [ "context" : "envParam:feedbackData", "actions" : [ $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); { "action" : "addClassName" "context" : "envParam:entity", { }, "event" : "unapproveMessage", count = 0; { LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "event" : "markAsSpamWithoutRedirect", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1765737 .lia-rating-control-passive', '#form_0'); Ferienhaus Poel Von Privat, Wechselgebet 7 Buchstaben, Auftaktspiel Wm 1982, Kühne Rotkohl Fix Und Fertig Angebote, Ausbildung Krankenpflegehelfer Stellenangebote, Gosausee - Bergfex, Wm 1930 Jugoslawien, Coleslaw Thermomix Buttermilch, Südwest Presse Horb, " />

"actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ })(LITHIUM.jQuery); } "event" : "unapproveMessage", }, } { { }, "linkDisabled" : "false" } { // just for convenience, you need a login anyways... }); ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "actions" : [ { "event" : "MessagesWidgetMessageEdit", "parameters" : { "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "QuickReply", watching = false; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { LITHIUM.AjaxSupport.ComponentEvents.set({ } ] { } } }, }, "eventActions" : [ "buttonDialogCloseAlt" : "Schließen", ] } LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }); "showCountOnly" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95793","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EUp2W-9ZlOXmtv1SjK6ib6LrBGNxeSoT77c0b6URhbk. "initiatorDataMatcher" : "data-lia-kudos-id" }, { "action" : "pulsate" "action" : "rerender" "message" : "2091090", }); { "context" : "lia-deleted-state", "eventActions" : [ { ], "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "actions" : [ "useTruncatedSubject" : "true", } "showCountOnly" : "false", "selector" : "#kudosButtonV2_8", "action" : "rerender" }, { "event" : "AcceptSolutionAction", } LITHIUM.Loader.runJsAttached(); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "componentId" : "forums.widget.message-view", "action" : "rerender" ] } "context" : "envParam:quiltName,message", }, logmein: [76, 79, 71, 77, 69, 73, 78], "componentId" : "forums.widget.message-view", }); "event" : "removeThreadUserEmailSubscription", "context" : "", "actions" : [ "actions" : [ "actions" : [ ] "actions" : [ "event" : "ProductMessageEdit", LITHIUM.AjaxSupport.ComponentEvents.set({ { } "action" : "pulsate" "event" : "approveMessage", }, }, "actions" : [ "disallowZeroCount" : "false", { "event" : "RevokeSolutionAction", { "action" : "rerender" "revokeMode" : "true", } "event" : "expandMessage", "actions" : [ "action" : "rerender" "context" : "", }, }, { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_65b5b97e353b8","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/7001/thread-id/95793&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":232889}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'Psx3wYmuNEoe1skMHR7V3poKQF4s8yMtoVyj_RiunzE. ] "context" : "", { { } Danke für diesen Hinweis. LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { { { }, Bist du sicher, dass du fortfahren möchtest? "actions" : [ { "actions" : [ "activecastFullscreen" : false, { "useSimpleView" : "false", "selector" : "#kudosButtonV2_1", { { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "truncateBodyRetainsHtml" : "false", "context" : "", { }, ] "action" : "addClassName" { "action" : "pulsate" "context" : "lia-deleted-state", } } var keycodes = { } { { "context" : "", "actions" : [ "action" : "rerender" ] "useCountToKudo" : "false", "event" : "addThreadUserEmailSubscription", "actions" : [ } "disableLabelLinks" : "false", "context" : "envParam:entity", } "action" : "rerender" "truncateBody" : "true", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.ComponentEvents.set({ { "displaySubject" : "true", } }, "context" : "envParam:entity", { var key = e.keyCode; LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "context" : "", } "kudosLinksDisabled" : "false", "actions" : [ "actions" : [ "context" : "", "action" : "pulsate" } "event" : "addMessageUserEmailSubscription", { "context" : "envParam:quiltName,message", LITHIUM.Dialog.options['662816016'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } ] element.siblings('li').removeClass('active'); { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", }, }); } "actions" : [ ] "context" : "envParam:entity", { "includeRepliesModerationState" : "false", "action" : "pulsate" }, ] }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", "action" : "rerender" "showCountOnly" : "false", "event" : "AcceptSolutionAction", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "MessagesWidgetEditCommentForm", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2094928,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); } var watching = false; //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} { } ;(function($) { { "event" : "RevokeSolutionAction", ] // just for convenience, you need a login anyways... LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/7001/thread-id/95793","ajaxErrorEventName":"LITHIUM:ajaxError","token":"CZx62GpElERd9GGV1DiRlAmecwDaDIXP2UaKx2bveQk. ;(function($) { setWarning(pagerId); "context" : "", { Setzen Sie Ihre Energie in etwas nützliche Hasser.. gute Arbeit Vodafone App funktioniert nicht. "event" : "kudoEntity", { { "linkDisabled" : "false" "actions" : [ } "componentId" : "kudos.widget.button", // console.log(key); { }, "quiltName" : "ForumMessage", "context" : "", }); "componentId" : "forums.widget.message-view", "actions" : [ "event" : "addMessageUserEmailSubscription", ;(function($){ "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ ', 'ajax'); "actions" : [ "linkDisabled" : "false" "event" : "MessagesWidgetEditCommentForm", } "actions" : [ }); "actions" : [ "parameters" : { }); { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" }, "context" : "", { "event" : "addMessageUserEmailSubscription", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { } "useCountToKudo" : "false", ] "actions" : [ "action" : "addClassName" ], "event" : "kudoEntity", ;(function($) { { { "action" : "rerender" }); ] "parameters" : { }, "displaySubject" : "true", ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'nOfeRGlqHKL2rlkDQOEO-o8iIRYxS-mJCznE-aOWhHQ. } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", { ] ] ], "event" : "ProductAnswer", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" } { }, { }, "action" : "rerender" "disallowZeroCount" : "false", "actions" : [ "event" : "MessagesWidgetCommentForm", "message" : "2095155", "event" : "addMessageUserEmailSubscription", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, ] "actions" : [ "event" : "MessagesWidgetMessageEdit", }, { "actions" : [ } "actions" : [ "action" : "rerender" "context" : "", "kudosLinksDisabled" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] ] } "event" : "ProductAnswer", "event" : "removeThreadUserEmailSubscription", "actions" : [ LITHIUM.Dialog.options['-297176650'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ { "event" : "MessagesWidgetEditAction", ;(function($) { } "context" : "envParam:quiltName,expandedQuiltName", }, }); { { LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); resetMenu(); }); }, "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "eventActions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAction", return false; "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "action" : "rerender" $(document).ready(function(){ { lithstudio: [], } { "actions" : [ "event" : "RevokeSolutionAction", "message" : "1763582", "event" : "deleteMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1763611 .lia-rating-control-passive', '#form_3'); { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "expandMessage", "selector" : "#messageview_6", "action" : "rerender" //$('#lia-body').addClass('lia-window-scroll'); // Oops, not the right sequence, lets restart from the top. }); { "eventActions" : [ ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "quiltName" : "ForumMessage", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); }, // just for convenience, you need a login anyways... "actions" : [ { if (1 != val) } '; { $('div[class*="-menu-btn"]').removeClass('active'); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $(document).keydown(function(e) { } }, { "parameters" : { $('#node-menu li.has-sub>a').on('click', function(){ { "}); ', 'ajax'); "context" : "", "parameters" : { "event" : "ProductMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", { "event" : "ProductAnswerComment", "event" : "ProductAnswer", } { }, } { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ } "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { }, }, "event" : "approveMessage", { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { "actions" : [ "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1763611,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" "revokeMode" : "true", { { } } } "useSubjectIcons" : "true", }, "actions" : [ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" { { "componentId" : "kudos.widget.button", "action" : "rerender" return true; "action" : "pulsate" "useSubjectIcons" : "true", }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", "event" : "deleteMessage", "action" : "rerender" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); ] { ;(function($) { "event" : "ProductAnswer", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetCommentForm", })(LITHIUM.jQuery); "disableLabelLinks" : "false", "action" : "rerender" ] LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", ;(function($) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "event" : "ProductMessageEdit", "context" : "", }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2091090 .lia-rating-control-passive', '#form_0'); $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { o.innerHTML = "Page must be in a numeric format. { { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { "revokeMode" : "true", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetCommentForm", { disableInput(pagerId); "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, "event" : "AcceptSolutionAction", "event" : "QuickReply", { "actions" : [ "event" : "removeThreadUserEmailSubscription", Gmail funktioniert nicht: Checke zunächst die Status-Übersicht Nicht immer muss es an Deinem Tun liegen, wenn der Google-Mailac­count ein­mal nicht wie gewohnt funk­tion­iert. "context" : "envParam:selectedMessage", "displayStyle" : "horizontal", "event" : "expandMessage", { ] "initiatorBinding" : true, ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.useTickets = false; "actions" : [ { } ] "action" : "rerender" "actions" : [ }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "quiltName" : "ForumMessage", "context" : "", } "context" : "envParam:selectedMessage", ] ] }); "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "MessagesWidgetEditAction", ] }, }, "context" : "", "componentId" : "kudos.widget.button", "truncateBodyRetainsHtml" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/7001/thread-id/95793","ajaxErrorEventName":"LITHIUM:ajaxError","token":"z7Tgg3vwp8-L9MoVvSa1jxfQGNgU8u6m6b3RAQ06Ras. "event" : "expandMessage", count++; "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_38cc7adf067d17","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/68876&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ;(function($) { "action" : "rerender" if (1 != val) { "action" : "addClassName" }); }, element.siblings('li').find('ul').slideUp(); "event" : "unapproveMessage", "actions" : [ { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1192,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk16AVxdYl0BVwBWXAdPegFcXX9TB1MKFHdPL1YNWW8bZApSB19dDAcaJUVDGVQQWA1NWw0MXgFHRxlcDFUOTW5NFlNJRW8bAFUPVg4HVEAbRlNBVV8AfwIbCFNQA1IMBw0EUABSDh5ACVQxRlZGewEUXBQDTkBcB2VSU1crVwtcEFhAcQtHRllmCkYPWmIDBVJGGRFfUShZBFBeB0ANRkFBQVdHGkRSUSANQ0YPEVJTCUUDGx5ACVQwTREOEFJVUwsDAQRUSVcBVgBIAgNbBk9bVV1UHgFTVAVRCVZWUQNdAxEYEA5VKFZWBytTRg8RAwJVB0QVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "action" : "rerender" }, LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ } "useTruncatedSubject" : "true", "actions" : [ }); "actions" : [ "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") }, ] "actions" : [ lithstudio: [], LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2095155,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "unapproveMessage", } }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, { { { } }, LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { "event" : "editProductMessage", "event" : "expandMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message", }, "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") "event" : "MessagesWidgetEditAction", LITHIUM.Dialog({ { { "useSimpleView" : "false", "action" : "rerender" }, ] "disallowZeroCount" : "false", }, { if ( Number(val) > 2 ) "context" : "", }, }, { "context" : "", } }); "initiatorDataMatcher" : "data-lia-message-uid" "event" : "ProductAnswerComment", "action" : "rerender" "action" : "rerender" { "actions" : [ "disableKudosForAnonUser" : "false", { { "context" : "envParam:quiltName,expandedQuiltName", }, ] }, "action" : "pulsate" "truncateBodyRetainsHtml" : "false", "action" : "rerender" }, "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ { "context" : "envParam:quiltName", } "displaySubject" : "true", { } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ { "context" : "", { { LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] "event" : "addThreadUserEmailSubscription", "actions" : [ "context" : "envParam:feedbackData", "actions" : [ $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); { "action" : "addClassName" "context" : "envParam:entity", { }, "event" : "unapproveMessage", count = 0; { LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "event" : "markAsSpamWithoutRedirect", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1765737 .lia-rating-control-passive', '#form_0');

Ferienhaus Poel Von Privat, Wechselgebet 7 Buchstaben, Auftaktspiel Wm 1982, Kühne Rotkohl Fix Und Fertig Angebote, Ausbildung Krankenpflegehelfer Stellenangebote, Gosausee - Bergfex, Wm 1930 Jugoslawien, Coleslaw Thermomix Buttermilch, Südwest Presse Horb,