0) { { "selector" : "#kudosButtonV2_5", { } LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ;(function($) { "messageViewOptions" : "1111110111111111111110111110100101011101" return; var keycodes = { ] "action" : "rerender" }, "actions" : [ "initiatorBinding" : true, ctaHTML += "Lösung noch nicht gefunden? }, "action" : "rerender" ] "context" : "", ] "action" : "pulsate" }, "message" : "1574243", { }, "triggerEvent" : "click", "event" : "expandMessage", { "actions" : [ "context" : "envParam:selectedMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "context" : "", } ] "actions" : [ { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { "action" : "rerender" } { }, "event" : "QuickReply", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ] { "event" : "ProductAnswer", { }, "actions" : [ ] { "event" : "removeThreadUserEmailSubscription", "actions" : [ "includeRepliesModerationState" : "false", "disableLinks" : "false", } "context" : "", count = 0; { }, "context" : "envParam:feedbackData", "context" : "", ] "selector" : "#kudosButtonV2_3", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "selector" : "#kudosButtonV2_1", "actions" : [ "actions" : [ }, } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { ] ] "context" : "", })(LITHIUM.jQuery); "action" : "rerender" "event" : "ProductAnswerComment", { LITHIUM.AjaxSupport.useTickets = false; { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { Danach nutzt Du die App ohne Zugangsdaten über WLAN. "event" : "deleteMessage", { { } "context" : "", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '_g1vrnxDIHmYOssBTghZsTaNqkXVx4T45OQvPETpAis. }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "event" : "MessagesWidgetMessageEdit", } "event" : "addThreadUserEmailSubscription", { { "context" : "lia-deleted-state", "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); "activecastFullscreen" : false, } $(this).addClass('active') "action" : "pulsate" "action" : "rerender" { $('.js-close-header-announcement').on('click', clickHandler); // If watching, pay attention to key presses, looking for right sequence. Execute whatever should happen when entering the right sequence } "action" : "rerender" Seit Anfang des Jahres 2019 funktioniert die App Mein Vodafone unter windows 10 auf meinem Lumia 950 XL nicht mehr. PDF-Viewer installieren. "event" : "approveMessage", "actions" : [ "}); }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "displayStyle" : "horizontal", "event" : "removeThreadUserEmailSubscription", "actions" : [ { { ] { "action" : "rerender" ] "context" : "lia-deleted-state", "disallowZeroCount" : "false", } LITHIUM.AjaxSupport.ComponentEvents.set({ ] "forceSearchRequestParameterForBlurbBuilder" : "false", }, "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); ] } else { }, "message" : "1574219", "disableKudosForAnonUser" : "false", "action" : "rerender" "disableLinks" : "false", "event" : "kudoEntity", ] "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosable" : "true", "event" : "deleteMessage", "disableLinks" : "false", { "action" : "rerender" "useSimpleView" : "false", { }, "event" : "removeThreadUserEmailSubscription", Die Community hilft!#bleibtgesund. Öffnen Sie die "Einstellungen"-App und wählen Sie dort die Kategorie "Allgemein" aus. "event" : "removeMessageUserEmailSubscription", "entity" : "1574219", "actions" : [ "event" : "removeMessageUserEmailSubscription", { { ] "actions" : [ "action" : "rerender" } { ] if ( watching ) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Z6qg4bh8LwlUDWNpuD5gcbw7vWr26bhvnXJ8nOJYHYQ. "actions" : [ "context" : "", { { }); { "action" : "rerender" "event" : "approveMessage", "actions" : [ "parameters" : { }, { // We're good so far. ] "initiatorBinding" : true, } // If watching, pay attention to key presses, looking for right sequence. }, "componentId" : "forums.widget.message-view", "context" : "", "closeEvent" : "LITHIUM:lightboxCloseEvent", })(LITHIUM.jQuery); "context" : "envParam:quiltName", { { ] { { ] "kudosable" : "true", "actions" : [ "context" : "envParam:quiltName", "event" : "MessagesWidgetEditAnswerForm", { } { } "actions" : [ } "event" : "unapproveMessage", "actions" : [ { ] ] }, "event" : "editProductMessage", "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '-ut_viuuUNppqEFvq9stPZbfAV8llwrAqj0I6h0oBoo. }, "actions" : [ }, ] "actions" : [ "action" : "rerender" } "context" : "envParam:feedbackData", "actions" : [ { "eventActions" : [ { }, { var key = e.keyCode; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } }, "context" : "", } return; ] { "actions" : [ "}); { "actions" : [ "action" : "rerender" { { "action" : "rerender" // We made it! }, }); { } { "context" : "", "parameters" : { "actions" : [ { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, { } } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" } { "action" : "pulsate" // We're good so far. "event" : "MessagesWidgetEditCommentForm", } { })(LITHIUM.jQuery); "actions" : [ element.addClass('active'); } }); "context" : "", "action" : "rerender" "initiatorBinding" : true, LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "event" : "ProductAnswer", ], }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" ], { ] "actions" : [ "parameters" : { "actions" : [ }, }); "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ }); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", }, "selector" : "#kudosButtonV2_4", } "linkDisabled" : "false" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } else { "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", }, ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Z6qg4bh8LwlUDWNpuD5gcbw7vWr26bhvnXJ8nOJYHYQ. } "actions" : [ "selector" : "#kudosButtonV2_0", "event" : "AcceptSolutionAction", "eventActions" : [ { "actions" : [ resetMenu(); }, LITHIUM.Dialog.options['142089393'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ ', 'ajax'); "action" : "rerender" "event" : "ProductAnswerComment", { "actions" : [ }, "actions" : [ "event" : "MessagesWidgetEditAction", "event" : "expandMessage", { LITHIUM.AjaxSupport.ComponentEvents.set({ ] LITHIUM.AjaxSupport.ComponentEvents.set({ } } Bist du sicher, dass du fortfahren möchtest? "action" : "addClassName" "event" : "ProductAnswerComment", "context" : "lia-deleted-state", { //resetMenu(); { }, "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, "useSubjectIcons" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); watching = false; "actions" : [ }, ;(function($) { "context" : "", "initiatorBinding" : true, } "event" : "addThreadUserEmailSubscription", Es kommt auch keine Fehlermeldung, sie öffnet sich einfach nicht. "disallowZeroCount" : "false", "activecastFullscreen" : false, ] }, "initiatorBinding" : true, "event" : "AcceptSolutionAction", var clickedDomElement = $(this); }, }, "; { "initiatorDataMatcher" : "data-lia-message-uid" { ] }, "action" : "pulsate" "event" : "editProductMessage", }); ] { { }, "disableLabelLinks" : "false", MeinVodafone App funktioniert nicht. "context" : "envParam:feedbackData", { "kudosable" : "true", }; { { }, // Set start to true only if the first key in the sequence is pressed "actions" : [ "actions" : [ { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName,expandedQuiltName", { { "selector" : "#messageview_4", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "removeMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "deleteMessage", "event" : "RevokeSolutionAction", "disallowZeroCount" : "false", "context" : "", { { "action" : "rerender" "actions" : [ "eventActions" : [ } "initiatorDataMatcher" : "data-lia-kudos-id" } ;(function($) { return; }, }, "parameters" : { count = 0; "displayStyle" : "horizontal", "actions" : [ { "actions" : [ } "action" : "rerender" { } "truncateBody" : "true", ', 'ajax'); }, "action" : "pulsate" }, "disallowZeroCount" : "false", "event" : "MessagesWidgetEditAction", "event" : "addThreadUserEmailSubscription", }, "action" : "rerender" "event" : "removeMessageUserEmailSubscription", ] "event" : "ProductAnswerComment", { "eventActions" : [ ] "action" : "pulsate" "event" : "RevokeSolutionAction", "context" : "", "context" : "", } "componentId" : "forums.widget.message-view", }, "action" : "rerender" } { }, "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } { { } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'lnDiHOPCyDZPAdvh7BMYPuUSECwsoLR6qlL4xRx9INw. "useTruncatedSubject" : "true", "truncateBody" : "true", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "", "event" : "MessagesWidgetMessageEdit", { "context" : "", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "disableKudosForAnonUser" : "false", "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" "action" : "rerender" { ] "context" : "", "context" : "", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }); if ( !watching ) { ] "actions" : [ { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { "action" : "rerender" { "context" : "envParam:quiltName", LITHIUM.Dialog.options['-20574463'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Codenames Undercover Unterschied, Uniklinik Ulm Kontakt, Garderoben Ideen Für Kleinen Flur, Eine Persische Kaiserin 5 Buchstaben, Low Carb Pudding Dr Oetker, Hautarzt 1020 Praterstraße, Tofu Panieren Paniermehl, L'osteria Essen Bestellen, Lynette Nusbacher Instagram, " />

"action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } { } "action" : "pulsate" "useTruncatedSubject" : "true", "initiatorBinding" : true, ] "action" : "rerender" { "event" : "MessagesWidgetCommentForm", }, "useSimpleView" : "false", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234350}); "context" : "envParam:quiltName", }, "action" : "rerender" "event" : "addMessageUserEmailSubscription", var clickHandler = function(event) { ] } "context" : "", "context" : "", { "action" : "rerender" "action" : "rerender" { "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" } $(document).ready(function(){ "initiatorDataMatcher" : "data-lia-message-uid" }, "event" : "markAsSpamWithoutRedirect", { "messageViewOptions" : "1111110111111111111110111110100101001101" .attr('aria-expanded','true'); "actions" : [ } "quiltName" : "ForumMessage", "disableLinks" : "false", { { { "event" : "expandMessage", { }, "initiatorDataMatcher" : "data-lia-message-uid" "buttonDialogCloseAlt" : "Schließen", { "context" : "envParam:quiltName", $('#community-menu-toggle').click(function() { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'ZDK9_WAzgoB9ID_zUNdAF6OKDMeEnoGz_e4iuonIQw4. "event" : "ProductMessageEdit", { lithstudio: [], } "event" : "removeThreadUserEmailSubscription", "actions" : [ "eventActions" : [ { { { } } LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "event" : "RevokeSolutionAction", '; })(LITHIUM.jQuery); { { { { "action" : "pulsate" }, } }, "event" : "MessagesWidgetEditAnswerForm", { } { ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetMessageEdit", "action" : "rerender" { { "useSubjectIcons" : "true", "accessibility" : false, }, "disableLinks" : "false", "parameters" : { { } LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "actions" : [ "context" : "", } "context" : "envParam:feedbackData", } "event" : "unapproveMessage", "context" : "", { "event" : "MessagesWidgetCommentForm", "context" : "", }, }, } "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "triggerEvent" : "click", "entity" : "1574243", ] "revokeMode" : "true", { "context" : "", "quiltName" : "ForumMessage", "action" : "rerender" }); }, "context" : "", $(this).toggleClass("view-btn-open view-btn-close"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bPGaZTqyTUtZJHUgRAPNLmT7qd7TUMA804V01k9Kqbw. watching = false; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1573018 .lia-rating-control-passive', '#form_1'); }, }, "showCountOnly" : "false", } ] } })(LITHIUM.jQuery); // Pull in global jQuery reference }, "event" : "MessagesWidgetAnswerForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { }, }, Zeigt, welche Beiträge Ihr cool findet – klickt auf „Gefällt mir“! "event" : "MessagesWidgetEditCommentForm", "initiatorDataMatcher" : "data-lia-kudos-id" { { { "action" : "rerender" ], .attr('aria-selected','false'); "showCountOnly" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "pulsate" "event" : "approveMessage", "showCountOnly" : "false", { { "action" : "rerender" ] "parameters" : { "kudosable" : "true", { "disableLabelLinks" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "pulsate" "context" : "", createStorage("false"); "event" : "MessagesWidgetCommentForm", } { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { "dialogContentCssClass" : "lia-panel-dialog-content", "kudosLinksDisabled" : "false", "context" : "", ] "action" : "rerender" "truncateBody" : "true", "context" : "", "context" : "", "context" : "", "actions" : [ "initiatorBinding" : true, } $('.lia-button-wrapper-searchForm-action').removeClass('active'); "action" : "rerender" "event" : "MessagesWidgetAnswerForm", Bist du sicher, dass du fortfahren möchtest? { "event" : "QuickReply", }, } "context" : "envParam:quiltName", "action" : "rerender" "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" { { { ] "event" : "deleteMessage", "defaultAriaLabel" : "", }); LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"syDFUemFjE30RpKgOWrO28PzXyp8LkOGhR7WkWXRPgE. ;(function($) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Tl7R5vE-k5z4fKMYgy3QGdx5L4OSZOzwbdkGNII1n3k. { ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "addThreadUserEmailSubscription", resetMenu(); "event" : "expandMessage", "event" : "MessagesWidgetEditCommentForm", { { { "linkDisabled" : "false" ] "action" : "rerender" "event" : "kudoEntity", "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"c9PdMn-OesDOmmVSbyjJ-yDq0DiqLfMFLZIFTIuP2EQ. "context" : "envParam:entity", "context" : "", })(LITHIUM.jQuery); "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { "componentId" : "kudos.widget.button", "action" : "rerender" { }, } } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }); "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" // Oops, not the right sequence, lets restart from the top. }, "event" : "deleteMessage", ] }, "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" "event" : "ProductAnswer", "componentId" : "forums.widget.message-view", "initiatorDataMatcher" : "data-lia-message-uid" "event" : "ProductAnswer", } { { if ( count == neededkeys.length ) { "event" : "AcceptSolutionAction", } "context" : "envParam:quiltName", "action" : "rerender" }, "action" : "rerender" "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", } "messageViewOptions" : "1111110111111111111110111110100101001101" "defaultAriaLabel" : "", }, "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574243 .lia-rating-control-passive', '#form_5'); }, "event" : "unapproveMessage", } } }, }); "actions" : [ "parameters" : { } }, $(this).toggleClass('active'); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { { "selector" : "#kudosButtonV2_5", { } LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ;(function($) { "messageViewOptions" : "1111110111111111111110111110100101011101" return; var keycodes = { ] "action" : "rerender" }, "actions" : [ "initiatorBinding" : true, ctaHTML += "Lösung noch nicht gefunden? }, "action" : "rerender" ] "context" : "", ] "action" : "pulsate" }, "message" : "1574243", { }, "triggerEvent" : "click", "event" : "expandMessage", { "actions" : [ "context" : "envParam:selectedMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "context" : "", } ] "actions" : [ { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { "action" : "rerender" } { }, "event" : "QuickReply", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); ] { "event" : "ProductAnswer", { }, "actions" : [ ] { "event" : "removeThreadUserEmailSubscription", "actions" : [ "includeRepliesModerationState" : "false", "disableLinks" : "false", } "context" : "", count = 0; { }, "context" : "envParam:feedbackData", "context" : "", ] "selector" : "#kudosButtonV2_3", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "selector" : "#kudosButtonV2_1", "actions" : [ "actions" : [ }, } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { ] ] "context" : "", })(LITHIUM.jQuery); "action" : "rerender" "event" : "ProductAnswerComment", { LITHIUM.AjaxSupport.useTickets = false; { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { Danach nutzt Du die App ohne Zugangsdaten über WLAN. "event" : "deleteMessage", { { } "context" : "", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '_g1vrnxDIHmYOssBTghZsTaNqkXVx4T45OQvPETpAis. }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "event" : "MessagesWidgetMessageEdit", } "event" : "addThreadUserEmailSubscription", { { "context" : "lia-deleted-state", "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); "activecastFullscreen" : false, } $(this).addClass('active') "action" : "pulsate" "action" : "rerender" { $('.js-close-header-announcement').on('click', clickHandler); // If watching, pay attention to key presses, looking for right sequence. Execute whatever should happen when entering the right sequence } "action" : "rerender" Seit Anfang des Jahres 2019 funktioniert die App Mein Vodafone unter windows 10 auf meinem Lumia 950 XL nicht mehr. PDF-Viewer installieren. "event" : "approveMessage", "actions" : [ "}); }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "displayStyle" : "horizontal", "event" : "removeThreadUserEmailSubscription", "actions" : [ { { ] { "action" : "rerender" ] "context" : "lia-deleted-state", "disallowZeroCount" : "false", } LITHIUM.AjaxSupport.ComponentEvents.set({ ] "forceSearchRequestParameterForBlurbBuilder" : "false", }, "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); ] } else { }, "message" : "1574219", "disableKudosForAnonUser" : "false", "action" : "rerender" "disableLinks" : "false", "event" : "kudoEntity", ] "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosable" : "true", "event" : "deleteMessage", "disableLinks" : "false", { "action" : "rerender" "useSimpleView" : "false", { }, "event" : "removeThreadUserEmailSubscription", Die Community hilft!#bleibtgesund. Öffnen Sie die "Einstellungen"-App und wählen Sie dort die Kategorie "Allgemein" aus. "event" : "removeMessageUserEmailSubscription", "entity" : "1574219", "actions" : [ "event" : "removeMessageUserEmailSubscription", { { ] "actions" : [ "action" : "rerender" } { ] if ( watching ) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Z6qg4bh8LwlUDWNpuD5gcbw7vWr26bhvnXJ8nOJYHYQ. "actions" : [ "context" : "", { { }); { "action" : "rerender" "event" : "approveMessage", "actions" : [ "parameters" : { }, { // We're good so far. ] "initiatorBinding" : true, } // If watching, pay attention to key presses, looking for right sequence. }, "componentId" : "forums.widget.message-view", "context" : "", "closeEvent" : "LITHIUM:lightboxCloseEvent", })(LITHIUM.jQuery); "context" : "envParam:quiltName", { { ] { { ] "kudosable" : "true", "actions" : [ "context" : "envParam:quiltName", "event" : "MessagesWidgetEditAnswerForm", { } { } "actions" : [ } "event" : "unapproveMessage", "actions" : [ { ] ] }, "event" : "editProductMessage", "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, '-ut_viuuUNppqEFvq9stPZbfAV8llwrAqj0I6h0oBoo. }, "actions" : [ }, ] "actions" : [ "action" : "rerender" } "context" : "envParam:feedbackData", "actions" : [ { "eventActions" : [ { }, { var key = e.keyCode; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } }, "context" : "", } return; ] { "actions" : [ "}); { "actions" : [ "action" : "rerender" { { "action" : "rerender" // We made it! }, }); { } { "context" : "", "parameters" : { "actions" : [ { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, { } } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" } { "action" : "pulsate" // We're good so far. "event" : "MessagesWidgetEditCommentForm", } { })(LITHIUM.jQuery); "actions" : [ element.addClass('active'); } }); "context" : "", "action" : "rerender" "initiatorBinding" : true, LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "event" : "ProductAnswer", ], }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" ], { ] "actions" : [ "parameters" : { "actions" : [ }, }); "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ }); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", }, "selector" : "#kudosButtonV2_4", } "linkDisabled" : "false" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } else { "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", }, ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Z6qg4bh8LwlUDWNpuD5gcbw7vWr26bhvnXJ8nOJYHYQ. } "actions" : [ "selector" : "#kudosButtonV2_0", "event" : "AcceptSolutionAction", "eventActions" : [ { "actions" : [ resetMenu(); }, LITHIUM.Dialog.options['142089393'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ ', 'ajax'); "action" : "rerender" "event" : "ProductAnswerComment", { "actions" : [ }, "actions" : [ "event" : "MessagesWidgetEditAction", "event" : "expandMessage", { LITHIUM.AjaxSupport.ComponentEvents.set({ ] LITHIUM.AjaxSupport.ComponentEvents.set({ } } Bist du sicher, dass du fortfahren möchtest? "action" : "addClassName" "event" : "ProductAnswerComment", "context" : "lia-deleted-state", { //resetMenu(); { }, "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, "useSubjectIcons" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); watching = false; "actions" : [ }, ;(function($) { "context" : "", "initiatorBinding" : true, } "event" : "addThreadUserEmailSubscription", Es kommt auch keine Fehlermeldung, sie öffnet sich einfach nicht. "disallowZeroCount" : "false", "activecastFullscreen" : false, ] }, "initiatorBinding" : true, "event" : "AcceptSolutionAction", var clickedDomElement = $(this); }, }, "; { "initiatorDataMatcher" : "data-lia-message-uid" { ] }, "action" : "pulsate" "event" : "editProductMessage", }); ] { { }, "disableLabelLinks" : "false", MeinVodafone App funktioniert nicht. "context" : "envParam:feedbackData", { "kudosable" : "true", }; { { }, // Set start to true only if the first key in the sequence is pressed "actions" : [ "actions" : [ { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName,expandedQuiltName", { { "selector" : "#messageview_4", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "removeMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "context" : "", "event" : "deleteMessage", "event" : "RevokeSolutionAction", "disallowZeroCount" : "false", "context" : "", { { "action" : "rerender" "actions" : [ "eventActions" : [ } "initiatorDataMatcher" : "data-lia-kudos-id" } ;(function($) { return; }, }, "parameters" : { count = 0; "displayStyle" : "horizontal", "actions" : [ { "actions" : [ } "action" : "rerender" { } "truncateBody" : "true", ', 'ajax'); }, "action" : "pulsate" }, "disallowZeroCount" : "false", "event" : "MessagesWidgetEditAction", "event" : "addThreadUserEmailSubscription", }, "action" : "rerender" "event" : "removeMessageUserEmailSubscription", ] "event" : "ProductAnswerComment", { "eventActions" : [ ] "action" : "pulsate" "event" : "RevokeSolutionAction", "context" : "", "context" : "", } "componentId" : "forums.widget.message-view", }, "action" : "rerender" } { }, "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } { { } LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'lnDiHOPCyDZPAdvh7BMYPuUSECwsoLR6qlL4xRx9INw. "useTruncatedSubject" : "true", "truncateBody" : "true", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "", "event" : "MessagesWidgetMessageEdit", { "context" : "", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "disableKudosForAnonUser" : "false", "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "addClassName" "action" : "rerender" { ] "context" : "", "context" : "", "actions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }); if ( !watching ) { ] "actions" : [ { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { "action" : "rerender" { "context" : "envParam:quiltName", LITHIUM.Dialog.options['-20574463'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Codenames Undercover Unterschied, Uniklinik Ulm Kontakt, Garderoben Ideen Für Kleinen Flur, Eine Persische Kaiserin 5 Buchstaben, Low Carb Pudding Dr Oetker, Hautarzt 1020 Praterstraße, Tofu Panieren Paniermehl, L'osteria Essen Bestellen, Lynette Nusbacher Instagram,