0) { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] watching = true; "displaySubject" : "true", "componentId" : "forums.widget.message-view", "action" : "rerender" }, ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] { "context" : "envParam:quiltName", "event" : "MessagesWidgetMessageEdit", "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "actions" : [ "disallowZeroCount" : "false", "disableLinks" : "false", { { } "context" : "", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] "disableLabelLinks" : "false", } { "context" : "", }, Leider ist das Gerät gebrandet und es existieren weder die Repeater- noch die Update-Option in der Admin Oberfläche. { Tracking: Wir und unsere Partner verarbeiten personenbezogene Daten, indem wir mit auf Ihrem Gerät gespeicherten Informationen (z. "actions" : [ "disableLinks" : "false", // We're good so far. }, "actions" : [ FritzBox 6490 Cable AVM Model DSL Box Wie Neu . "actions" : [ { }, { }, }, "buttonDialogCloseAlt" : "Schließen", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { "event" : "removeThreadUserEmailSubscription", }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":545,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIfwhNVxAMUhAYdFFAQHVVHHNWFlI4GnVGWxFMBFZKT1QDXQUed1MHWgMUVBAHXklDXFofB0QHV1YLDFA4GkdQHxVqSQgEUVAHUQ0RGBADRAdUVysGFV4EAQAEXAdUAQRRUwVIF1hXZxZTFHBWQFgaVRkRX1E1VwFcfAMPUkYPEXJdF0MLbV0SC1Q0VFRREEkUDVp\/DQBeCFARDhADVwpKV0BOFQ9WcVtGRwxEX1MOEVJGGRFfUTFORAMQVVAOUAwHB1NIAQVdBk9WUlFUHgxQAwJLCQtSW1FQAVYHVlFTRBUQCQF5C1FWfVZHDER4QAEKXhJ+emQQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "eventActions" : [ "actions" : [ ], "actions" : [ "actions" : [ "}); }, LITHIUM.Dialog.options['-809825241'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); } "context" : "envParam:quiltName,message,product,contextId,contextUrl", var handleClose = function(event) { "context" : "", "action" : "addClassName" ] ] } { { { }); "quiltName" : "ForumMessage", ] { { "actions" : [ "actions" : [ { } "action" : "pulsate" { { ] ] ] "context" : "", } } "context" : "", { }, "context" : "", ] ctaHTML += 'Stell Deine Frage'; { { "useSimpleView" : "false", $(document).ready(function() { ] "useTruncatedSubject" : "true", Bist du sicher, dass du fortfahren möchtest? } "event" : "QuickReply", Windows 10 Create Recovery Partition, Bauamt Demmin öffnungszeiten, Spreepark Berlin Wiedereröffnung, Ikea Pax Schublade, Ihk Stuttgart Corona Prüfung, Codenames Undercover Zu Zweit, Ikea Karlsruhe öffnungszeiten Restaurant, " />

{ "selector" : "#kudosButtonV2_5", } "floatedBlock" : "acceptedSolutions", "context" : "", ] { "event" : "RevokeSolutionAction", { "actions" : [ ;(function($) { } }, { } ] { { "actions" : [ { "useCountToKudo" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:entity", { "actions" : [ { }, } "actions" : [ "componentId" : "kudos.widget.button", { $('section.header-announcement').slideUp(); LITHIUM.AjaxSupport.ComponentEvents.set({ "displayStyle" : "horizontal", ], "action" : "rerender" { "actions" : [ "actions" : [ "event" : "ProductAnswer", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/70898","ajaxErrorEventName":"LITHIUM:ajaxError","token":"VWINM5lrrJJhnZxZ-zBsY54y8jcKfqoFyQwj87qIKZc. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "selector" : "#kudosButtonV2_0", ] }, }); ] { watching = false; } ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "action" : "rerender" { "event" : "MessagesWidgetMessageEdit", { { "actions" : [ "actions" : [ ] "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); }, count = 0; }, }, LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "event" : "MessagesWidgetEditAnswerForm", }, "action" : "rerender" "initiatorBinding" : true, } ] "useSimpleView" : "false", "actions" : [ "displayStyle" : "horizontal", }, { }, // just for convenience, you need a login anyways... "action" : "rerender" "truncateBodyRetainsHtml" : "false", { ;(function($) { "initiatorBinding" : true, } "action" : "rerender" "useSubjectIcons" : "true", ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", { } "useTruncatedSubject" : "true", "event" : "addMessageUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'kTSD1bguCCzKAMj7a88oCa7f_zKcQG9R5-jfUygRjh8. watching = false; "disableLinks" : "false", "showCountOnly" : "false", "action" : "rerender" ] { } } "action" : "rerender" '; // console.log(key); "event" : "MessagesWidgetEditAction", "displayStyle" : "horizontal", "context" : "envParam:quiltName,expandedQuiltName", { ] "componentId" : "kudos.widget.button", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "actions" : [ "action" : "rerender" } "actions" : [ ] "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1632237 .lia-rating-control-passive', '#form_5'); "useSimpleView" : "false", "selector" : "#messageview_4", lithstudio: [], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1632112 .lia-rating-control-passive', '#form_1'); ], } }, "event" : "unapproveMessage", }, "quiltName" : "ForumMessage", ] "actions" : [ ], "actions" : [ "initiatorBinding" : true, ] }, }); if (event.target.matches('.redirect')) { }); { } { "useSimpleView" : "false", ] "truncateBody" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] ] { } "disableKudosForAnonUser" : "false", "action" : "rerender" } } else { ] { "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", Eine Fritzbox ist auch nur ein Computer. "context" : "envParam:quiltName,product,contextId,contextUrl", ] }, ;(function($) { { } { "context" : "", "parameters" : { { ] }, "event" : "editProductMessage", } }, "event" : "ProductAnswer", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/70898","ajaxErrorEventName":"LITHIUM:ajaxError","token":"1e_GLtV8ajS2ZOLWaAs5_cUN7xcw2at3WtyIu_nGngs. "context" : "envParam:quiltName,expandedQuiltName", "kudosLinksDisabled" : "false", { { { "action" : "rerender" "event" : "QuickReply", { "useTruncatedSubject" : "true", ] var key = e.keyCode; Nicht zuletzt.. ... Fritzbox: Branding … } ] { "event" : "unapproveMessage", "quiltName" : "ForumMessage", "eventActions" : [ "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); ] { ] } //$('#lia-body').addClass('lia-window-scroll'); { ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", }, "accessibility" : false, NETZTEIL für AVM Fritzbox 6490 7390 7490 / Speedport W724V W921V - 12V 2,5A. "closeEvent" : "LITHIUM:lightboxCloseEvent", ;(function($) { Habe ich etwas Falsch gemacht ?? "action" : "rerender" }, die 5€ Miete sind für 2 Teleleitungen und 6 Rufnummern und Dect. "action" : "rerender" $(document).keydown(function(e) { }, }, "action" : "rerender" { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", count = 0; { } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1632112,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", { }, "action" : "rerender" "activecastFullscreen" : false, } }); "action" : "pulsate" "context" : "", "event" : "QuickReply", }, } { "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); { var keycodes = { "event" : "unapproveMessage", "action" : "rerender" ] } ] "event" : "addMessageUserEmailSubscription", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); })(LITHIUM.jQuery); ] "context" : "", ] "action" : "rerender" } "eventActions" : [ }, "actions" : [ }, "action" : "rerender" }, "disallowZeroCount" : "false", Ersteller des Themas lethuer; Erstellungsdatum 22. ], { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); AVM Inhalt. // We made it! }, }, "action" : "rerender" "actions" : [ "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useTruncatedSubject" : "true", ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog({ { "context" : "envParam:quiltName,message", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); } // Oops, not the right sequence, lets restart from the top. "context" : "envParam:quiltName,expandedQuiltName", return; "context" : "", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ] "componentId" : "kudos.widget.button", } { { { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'UqLjdlV-hgtw7bWl2BRY3lPaeMhOX0aCGADx-i86C8I. }, } "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } { ], ] }, "forceSearchRequestParameterForBlurbBuilder" : "false", "disableLabelLinks" : "false", }, { { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "useCountToKudo" : "false", LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1eda11766b95ee","tooltipContentSelector":"#link_1eda11766b95ee_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1eda11766b95ee_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "context" : "", })(LITHIUM.jQuery); "context" : "", }, { { { "action" : "rerender" { { "initiatorBinding" : true, } count = 0; ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(this).toggleClass('active'); } "actions" : [ "event" : "approveMessage", }, "disableKudosForAnonUser" : "false", ] } LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "actions" : [ "action" : "rerender" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1632199,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_1eda11766b95ee","nodesModel":{"Endgeraete|category":{"title":"Kategorie-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"ArchivKIP|forum-board":{"title":"Board-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_1eda11766b95ee_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "context" : "", ] LITHIUM.Loader.runJsAttached(); "event" : "RevokeSolutionAction", "actions" : [ "context" : "", "actions" : [ } ', 'ajax'); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "actions" : [ { "; } ] { } "message" : "1632237", { "action" : "rerender" { { { "actions" : [ "event" : "expandMessage", EUR 9,90. } "event" : "unapproveMessage", "event" : "RevokeSolutionAction", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); }, "selector" : "#kudosButtonV2_3", } }, "event" : "ProductAnswer", "event" : "MessagesWidgetEditCommentForm", "event" : "unapproveMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "action" : "rerender" { //var height = $(window).scrollTop(); "useTruncatedSubject" : "true", }, ] $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "truncateBody" : "true", "event" : "AcceptSolutionAction", ] "entity" : "1632237", $(document).ready(function(){ "event" : "approveMessage", } "actions" : [ ;(function($) { "context" : "", ] LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" { }, "action" : "pulsate" "messageViewOptions" : "1111110111111111111110111110100101001101" { }, "action" : "addClassName" }, ] "componentId" : "forums.widget.message-view", { }, ] "}); { "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetCommentForm", // Set start to true only if the first key in the sequence is pressed "actions" : [ }, "actions" : [ "selector" : "#kudosButtonV2_3", "event" : "MessagesWidgetEditAction", "action" : "rerender" "action" : "rerender" } }, ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "kudoEntity", "messageViewOptions" : "1111110111111111111110111110100101001101" Nur noch wer unbedingt immer sofort das neueste Update haben will ist mit einer freien Box besser bedient. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); "action" : "rerender" "event" : "approveMessage", "actions" : [ var resetMenu = function() { "event" : "QuickReply", "}); "context" : "lia-deleted-state", } "event" : "addThreadUserEmailSubscription", } ctaHTML += "Lösung noch nicht gefunden? "action" : "rerender" "disableKudosForAnonUser" : "false", "actions" : [ "actions" : [ "kudosLinksDisabled" : "false", "actions" : [ }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); }, }, { ] } "actions" : [ "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", "event" : "MessagesWidgetCommentForm", ] { ] "eventActions" : [ "action" : "rerender" { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1632131 .lia-rating-control-passive', '#form_2'); "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "kudosLinksDisabled" : "false", "actions" : [ { }, "actions" : [ Hallo, wir haben ständig Probleme mit der FritzBox 6490, das WLAN ist extrem instabil. "context" : "lia-deleted-state", "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], })(LITHIUM.jQuery); }, } }); } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ }, ] "action" : "rerender" if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] watching = true; "displaySubject" : "true", "componentId" : "forums.widget.message-view", "action" : "rerender" }, ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] { "context" : "envParam:quiltName", "event" : "MessagesWidgetMessageEdit", "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "actions" : [ "disallowZeroCount" : "false", "disableLinks" : "false", { { } "context" : "", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] "disableLabelLinks" : "false", } { "context" : "", }, Leider ist das Gerät gebrandet und es existieren weder die Repeater- noch die Update-Option in der Admin Oberfläche. { Tracking: Wir und unsere Partner verarbeiten personenbezogene Daten, indem wir mit auf Ihrem Gerät gespeicherten Informationen (z. "actions" : [ "disableLinks" : "false", // We're good so far. }, "actions" : [ FritzBox 6490 Cable AVM Model DSL Box Wie Neu . "actions" : [ { }, { }, }, "buttonDialogCloseAlt" : "Schließen", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { "event" : "removeThreadUserEmailSubscription", }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":545,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIfwhNVxAMUhAYdFFAQHVVHHNWFlI4GnVGWxFMBFZKT1QDXQUed1MHWgMUVBAHXklDXFofB0QHV1YLDFA4GkdQHxVqSQgEUVAHUQ0RGBADRAdUVysGFV4EAQAEXAdUAQRRUwVIF1hXZxZTFHBWQFgaVRkRX1E1VwFcfAMPUkYPEXJdF0MLbV0SC1Q0VFRREEkUDVp\/DQBeCFARDhADVwpKV0BOFQ9WcVtGRwxEX1MOEVJGGRFfUTFORAMQVVAOUAwHB1NIAQVdBk9WUlFUHgxQAwJLCQtSW1FQAVYHVlFTRBUQCQF5C1FWfVZHDER4QAEKXhJ+emQQSRQNWmAHEUMyB2JBVxdPRAMQMSd7IXZnFFsBFiBrfS9CWgFGQFVVAEVGbnonMHJEQVxEWwYYD10PXUJ7LXh6YBJaFBtE"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "eventActions" : [ "actions" : [ ], "actions" : [ "actions" : [ "}); }, LITHIUM.Dialog.options['-809825241'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); } "context" : "envParam:quiltName,message,product,contextId,contextUrl", var handleClose = function(event) { "context" : "", "action" : "addClassName" ] ] } { { { }); "quiltName" : "ForumMessage", ] { { "actions" : [ "actions" : [ { } "action" : "pulsate" { { ] ] ] "context" : "", } } "context" : "", { }, "context" : "", ] ctaHTML += 'Stell Deine Frage'; { { "useSimpleView" : "false", $(document).ready(function() { ] "useTruncatedSubject" : "true", Bist du sicher, dass du fortfahren möchtest? } "event" : "QuickReply",

Windows 10 Create Recovery Partition, Bauamt Demmin öffnungszeiten, Spreepark Berlin Wiedereröffnung, Ikea Pax Schublade, Ihk Stuttgart Corona Prüfung, Codenames Undercover Zu Zweit, Ikea Karlsruhe öffnungszeiten Restaurant,