430) { "linkDisabled" : "false" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "context" : "", { }, "context" : "", "event" : "addMessageUserEmailSubscription", }, $(this).next().toggle(); }, { "triggerEvent" : "click", { '; "event" : "deleteMessage", einmal neu. "action" : "pulsate" "dialogContentCssClass" : "lia-panel-dialog-content", "showCountOnly" : "false", }, ] "includeRepliesModerationState" : "false", "disableKudosForAnonUser" : "false", "context" : "envParam:feedbackData", { ] "parameters" : { } { { "event" : "RevokeSolutionAction", ] "action" : "rerender" }, "action" : "rerender" "event" : "approveMessage", "event" : "ProductAnswer", { { }); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { element.find('ul').slideUp(); // If watching, pay attention to key presses, looking for right sequence. $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); }, "context" : "envParam:quiltName", "actions" : [ // Set start to true only if the first key in the sequence is pressed "useSimpleView" : "false", "event" : "addThreadUserEmailSubscription", ] LITHIUM.Dialog.options['180643222'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); { "context" : "envParam:quiltName", return; "componentId" : "forums.widget.message-view", "action" : "rerender" ] "actions" : [ $(this).addClass('active') } "revokeMode" : "true", { "context" : "envParam:quiltName", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_vnvQdArIErREdQT7NQqXzIC-4C7oySXaE_I-e_y0BA. }, if ( watching ) { { Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65addd5cb1def', 'disableAutoComplete', '#ajaxfeedback_65addd5a1896b_0', 'LITHIUM:ajaxError', {}, 'JvFDHYLu_OL4AbIV5kgMiZeXpXFBTMxaAil3njLpoC8. "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "linkDisabled" : "false" $(document).ready(function(){ } "event" : "ProductAnswer", "action" : "rerender" }, }, { { "context" : "envParam:feedbackData", "event" : "MessagesWidgetCommentForm", $(this).toggleClass("view-btn-open view-btn-close"); }, // console.log('watching: ' + key); { { "context" : "envParam:entity", Registered in England No 1471587. window.scrollTo(0,position_x.top - 150); "displayStyle" : "horizontal", { Internet zum streamen oder gamen so gut wie nicht brauchbar. "truncateBodyRetainsHtml" : "false", }, "context" : "", "context" : "", { ] "actions" : [ } { "accessibility" : false, "context" : "", } }, "context" : "", "event" : "AcceptSolutionAction", "componentId" : "forums.widget.message-view", "action" : "rerender" { }); }, var key = e.keyCode; "componentId" : "kudos.widget.button", } }); var clickedDomElement = $(this); { $(this).addClass('active') "context" : "", } ] "eventActions" : [ "actions" : [ "context" : "", "context" : "envParam:entity", "event" : "MessagesWidgetEditAnswerForm", createStorage("true"); "event" : "MessagesWidgetEditCommentForm", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" ] { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ "actions" : [ }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ // just for convenience, you need a login anyways... }, { "event" : "kudoEntity", var element = $(this).parent('li'); "event" : "MessagesWidgetEditAction", "event" : "approveMessage", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.Dialog.options['180643222'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; sessionStorage.setItem("is_scroll", option); "event" : "MessagesWidgetEditCommentForm", "event" : "removeMessageUserEmailSubscription", "actions" : [ }, } } }, "action" : "rerender" }, }, } }, "quiltName" : "ForumMessage", "event" : "ProductAnswerComment", "event" : "expandMessage", "quiltName" : "ForumMessage", }, "event" : "ProductAnswer", "event" : "approveMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cSLy-o1S8AQTDeeZQBVHvWLwsspRaStlZfQpEtaC-08. "context" : "lia-deleted-state", "event" : "QuickReply", }, { "action" : "rerender" ] ] "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "kudosable" : "true", "truncateBodyRetainsHtml" : "false", "event" : "ProductMessageEdit", ] LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, This product hasn't been reviewed yet. "context" : "", createStorage("false"); { } { { "event" : "removeMessageUserEmailSubscription", "}); "actions" : [ }, "context" : "", This is a locked archive and content on this page may no longer be up to date. }, var handleClose = function(event) { "selector" : "#kudosButtonV2_2", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ], $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); }, }, "event" : "QuickReply", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", "event" : "removeMessageUserEmailSubscription", { } ] "context" : "envParam:quiltName,message", "context" : "", "actions" : [ } window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ] 2.1 Connecting your Vodafone Station to the fi xed network As per the Set-up Wizard step on your LCD screen, please connect your computer to the Vodafone Station using the white cable with yellow tags provided. { count = 0; ] "initiatorBinding" : true, { }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }, { "action" : "rerender" "actions" : [ } "context" : "envParam:quiltName,message", ] { "event" : "expandMessage", "initiatorDataMatcher" : "data-lia-message-uid" { { "action" : "rerender" "context" : "", { { // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" "useSimpleView" : "false", LITHIUM.AjaxSupport.useTickets = false; "event" : "MessagesWidgetEditCommentForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { .attr('aria-selected','true'); "componentId" : "forums.widget.message-view", "event" : "markAsSpamWithoutRedirect", }, watching = false; }, ] event.returnValue = false; Zusätzlich startet mein Router, aus einem mir unersichtlichen Grund, täglich min. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194592 .lia-rating-control-passive', '#form_1'); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "action" : "pulsate" { { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); } }, { $('#vodafone-community-header').toggle(); { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '6lxfR_uH2-wqO7Mk4qAGdSvJmKAEtPEgHQ3s_s8zX8M. ] "event" : "deleteMessage", "defaultAriaLabel" : "", "action" : "rerender" "actions" : [ } "action" : "rerender" { "dialogContentCssClass" : "lia-panel-dialog-content", { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); }, Behoben Eisleben: Einschränkung der Festnetz-Telefonie, Behoben Oscherlseben: Einschränkung der Mobilen Telefonie und Daten, MeinVodafone-App/-Web:  Automatisches Logout beim Aufrufen von "Mein Tarif", Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pmfUI7ePt0Uh4CagVJbWbOdmvF4ZnVZg_NvW1oLcVic. { { { "action" : "rerender" "actions" : [ { $('div[class*="-menu-btn"]').removeClass('active'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { ] "showCountOnly" : "false", Check your real speeds on Vodafone people, go to, and check real speeds you are getting. "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); ctaHTML += 'Stell Deine Frage'; }); "actions" : [ { { } "context" : "", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditAction", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { return; ] "quiltName" : "ForumMessage", "action" : "rerender" { "event" : "MessagesWidgetCommentForm", //$('#community-menu-toggle').removeClass('active') watching = true; }, "initiatorBinding" : true, watching = false; { ] ] Execute whatever should happen when entering the right sequence alle 10-15 Sekunden tritt der Packet Loss auf. { "event" : "MessagesWidgetMessageEdit", "parameters" : { "event" : "MessagesWidgetCommentForm", "actions" : [ "actions" : [ "action" : "pulsate" }); "context" : "", element.addClass('active'); Meine Partnerin und ich können seitdem nicht mehr im Homeoffice arbeiten. var resetMenu = function() { "quiltName" : "ForumMessage", { { })(LITHIUM.jQuery); "context" : "", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }); { } notifCount = parseInt($(this).html()) + notifCount; "event" : "approveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ev4kanirJLV2vgMFGCvmajjs0GvIVGY4Odsr0kL7T1k. Bist du sicher, dass du fortfahren möchtest? }, "event" : "MessagesWidgetMessageEdit", "context" : "", } } else { //}); if (element.hasClass('active')) { // Register the click event handler }, "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "dialogKey" : "dialogKey" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194560 .lia-rating-control-passive', '#form_0'); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Das Beste Für Mein Kind Vox Folge 3, Knacken Im Holz Holzwurm, City Döner Warstein Speisekarte, Pension Den Haag Mit Hund, Pans Kitchen Speisekarte, Fichtelberg Schwebebahn öffnungszeiten, " />

{ { element.removeClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65addd5a1896b_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" "action" : "rerender" //if(height > 430) { "linkDisabled" : "false" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "context" : "", { }, "context" : "", "event" : "addMessageUserEmailSubscription", }, $(this).next().toggle(); }, { "triggerEvent" : "click", { '; "event" : "deleteMessage", einmal neu. "action" : "pulsate" "dialogContentCssClass" : "lia-panel-dialog-content", "showCountOnly" : "false", }, ] "includeRepliesModerationState" : "false", "disableKudosForAnonUser" : "false", "context" : "envParam:feedbackData", { ] "parameters" : { } { { "event" : "RevokeSolutionAction", ] "action" : "rerender" }, "action" : "rerender" "event" : "approveMessage", "event" : "ProductAnswer", { { }); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { element.find('ul').slideUp(); // If watching, pay attention to key presses, looking for right sequence. $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); }, "context" : "envParam:quiltName", "actions" : [ // Set start to true only if the first key in the sequence is pressed "useSimpleView" : "false", "event" : "addThreadUserEmailSubscription", ] LITHIUM.Dialog.options['180643222'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); { "context" : "envParam:quiltName", return; "componentId" : "forums.widget.message-view", "action" : "rerender" ] "actions" : [ $(this).addClass('active') } "revokeMode" : "true", { "context" : "envParam:quiltName", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_vnvQdArIErREdQT7NQqXzIC-4C7oySXaE_I-e_y0BA. }, if ( watching ) { { Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65addd5cb1def', 'disableAutoComplete', '#ajaxfeedback_65addd5a1896b_0', 'LITHIUM:ajaxError', {}, 'JvFDHYLu_OL4AbIV5kgMiZeXpXFBTMxaAil3njLpoC8. "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "linkDisabled" : "false" $(document).ready(function(){ } "event" : "ProductAnswer", "action" : "rerender" }, }, { { "context" : "envParam:feedbackData", "event" : "MessagesWidgetCommentForm", $(this).toggleClass("view-btn-open view-btn-close"); }, // console.log('watching: ' + key); { { "context" : "envParam:entity", Registered in England No 1471587. window.scrollTo(0,position_x.top - 150); "displayStyle" : "horizontal", { Internet zum streamen oder gamen so gut wie nicht brauchbar. "truncateBodyRetainsHtml" : "false", }, "context" : "", "context" : "", { ] "actions" : [ } { "accessibility" : false, "context" : "", } }, "context" : "", "event" : "AcceptSolutionAction", "componentId" : "forums.widget.message-view", "action" : "rerender" { }); }, var key = e.keyCode; "componentId" : "kudos.widget.button", } }); var clickedDomElement = $(this); { $(this).addClass('active') "context" : "", } ] "eventActions" : [ "actions" : [ "context" : "", "context" : "envParam:entity", "event" : "MessagesWidgetEditAnswerForm", createStorage("true"); "event" : "MessagesWidgetEditCommentForm", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" ] { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "actions" : [ "actions" : [ }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ // just for convenience, you need a login anyways... }, { "event" : "kudoEntity", var element = $(this).parent('li'); "event" : "MessagesWidgetEditAction", "event" : "approveMessage", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.Dialog.options['180643222'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; sessionStorage.setItem("is_scroll", option); "event" : "MessagesWidgetEditCommentForm", "event" : "removeMessageUserEmailSubscription", "actions" : [ }, } } }, "action" : "rerender" }, }, } }, "quiltName" : "ForumMessage", "event" : "ProductAnswerComment", "event" : "expandMessage", "quiltName" : "ForumMessage", }, "event" : "ProductAnswer", "event" : "approveMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cSLy-o1S8AQTDeeZQBVHvWLwsspRaStlZfQpEtaC-08. "context" : "lia-deleted-state", "event" : "QuickReply", }, { "action" : "rerender" ] ] "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "kudosable" : "true", "truncateBodyRetainsHtml" : "false", "event" : "ProductMessageEdit", ] LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, This product hasn't been reviewed yet. "context" : "", createStorage("false"); { } { { "event" : "removeMessageUserEmailSubscription", "}); "actions" : [ }, "context" : "", This is a locked archive and content on this page may no longer be up to date. }, var handleClose = function(event) { "selector" : "#kudosButtonV2_2", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ], $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); }, }, "event" : "QuickReply", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", "event" : "removeMessageUserEmailSubscription", { } ] "context" : "envParam:quiltName,message", "context" : "", "actions" : [ } window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, ] 2.1 Connecting your Vodafone Station to the fi xed network As per the Set-up Wizard step on your LCD screen, please connect your computer to the Vodafone Station using the white cable with yellow tags provided. { count = 0; ] "initiatorBinding" : true, { }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); }, { "action" : "rerender" "actions" : [ } "context" : "envParam:quiltName,message", ] { "event" : "expandMessage", "initiatorDataMatcher" : "data-lia-message-uid" { { "action" : "rerender" "context" : "", { { // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" "useSimpleView" : "false", LITHIUM.AjaxSupport.useTickets = false; "event" : "MessagesWidgetEditCommentForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { .attr('aria-selected','true'); "componentId" : "forums.widget.message-view", "event" : "markAsSpamWithoutRedirect", }, watching = false; }, ] event.returnValue = false; Zusätzlich startet mein Router, aus einem mir unersichtlichen Grund, täglich min. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194592 .lia-rating-control-passive', '#form_1'); { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "action" : "pulsate" { { { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); } }, { $('#vodafone-community-header').toggle(); { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '6lxfR_uH2-wqO7Mk4qAGdSvJmKAEtPEgHQ3s_s8zX8M. ] "event" : "deleteMessage", "defaultAriaLabel" : "", "action" : "rerender" "actions" : [ } "action" : "rerender" { "dialogContentCssClass" : "lia-panel-dialog-content", { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); }, Behoben Eisleben: Einschränkung der Festnetz-Telefonie, Behoben Oscherlseben: Einschränkung der Mobilen Telefonie und Daten, MeinVodafone-App/-Web:  Automatisches Logout beim Aufrufen von "Mein Tarif", Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/260368","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pmfUI7ePt0Uh4CagVJbWbOdmvF4ZnVZg_NvW1oLcVic. { { { "action" : "rerender" "actions" : [ { $('div[class*="-menu-btn"]').removeClass('active'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { ] "showCountOnly" : "false", Check your real speeds on Vodafone people, go to, and check real speeds you are getting. "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); ctaHTML += 'Stell Deine Frage'; }); "actions" : [ { { } "context" : "", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "MessagesWidgetEditAction", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { return; ] "quiltName" : "ForumMessage", "action" : "rerender" { "event" : "MessagesWidgetCommentForm", //$('#community-menu-toggle').removeClass('active') watching = true; }, "initiatorBinding" : true, watching = false; { ] ] Execute whatever should happen when entering the right sequence alle 10-15 Sekunden tritt der Packet Loss auf. { "event" : "MessagesWidgetMessageEdit", "parameters" : { "event" : "MessagesWidgetCommentForm", "actions" : [ "actions" : [ "action" : "pulsate" }); "context" : "", element.addClass('active'); Meine Partnerin und ich können seitdem nicht mehr im Homeoffice arbeiten. var resetMenu = function() { "quiltName" : "ForumMessage", { { })(LITHIUM.jQuery); "context" : "", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }); { } notifCount = parseInt($(this).html()) + notifCount; "event" : "approveMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ev4kanirJLV2vgMFGCvmajjs0GvIVGY4Odsr0kL7T1k. Bist du sicher, dass du fortfahren möchtest? }, "event" : "MessagesWidgetMessageEdit", "context" : "", } } else { //}); if (element.hasClass('active')) { // Register the click event handler }, "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "dialogKey" : "dialogKey" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2194560 .lia-rating-control-passive', '#form_0'); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":690,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZTBF0FBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVVUwRWBVBTAhRUVwcASQFSAQBIV1UKCk8EU1NUUgwLBwRUDwJAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"};

Das Beste Für Mein Kind Vox Folge 3, Knacken Im Holz Holzwurm, City Döner Warstein Speisekarte, Pension Den Haag Mit Hund, Pans Kitchen Speisekarte, Fichtelberg Schwebebahn öffnungszeiten,