Pizzeria Mindelstetten Il Ritrovo, Vogel Wie Alarmanlage, Ort An Der Etsch, Italienisches Restaurant Marktoberdorf, Modetrends 2021 Herren, Cafe Mexx Hattingen, Phantasialand Unfall, Winjas, " />

Explore our interactive Future Ready Report, Tailor your insights and take the questionnaire to see how your business compares, Discover how we can help make the future incredible, Discover how IoT is changing business strategy, Get your workplace COVID-secure as you plan your employees’ return to work, Digital business insight and one-to-one support, Four customers, four countries, their stories. } ] ] ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "event" : "AcceptSolutionAction", { "displaySubject" : "true", ] "action" : "rerender" ] { "actions" : [ ] } "context" : "", { { { "disableKudosForAnonUser" : "false", { "context" : "", "action" : "rerender" } } }); LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "context" : "", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'FEL3y5qMAYyZB1pLgci0ufVxxUCd5LYnybWdqgKk2Ks. ] "actions" : [ } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ic4bPvHUwEPZ1Y1qE_b-ZJJiWQ-AczJWzuKQ0UU10aA. "action" : "rerender" } { "context" : "", "context" : "", { ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'deBiwdcA9lBuaS8yFQWbaJvNThApV31-emBG1PyQJng. } { "context" : "envParam:quiltName,message", "entity" : "2066914", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { "context" : "", { "action" : "rerender" { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '9wspBmtb1H1O5nPCl--h_IEsCLWA9oUCtk_0mMwNuHo. "forceSearchRequestParameterForBlurbBuilder" : "false", var key = e.keyCode; "actions" : [ "context" : "envParam:selectedMessage", "event" : "expandMessage", Sustain your organisation's success by keeping … ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); { "context" : "", } ] LITHIUM.AjaxSupport.ComponentEvents.set({ }); }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QNj-goKISaLK9FJ6GnHi8RCkHy0pCUYA9BMa8YxflnI. { { { { "displaySubject" : "true", "messageViewOptions" : "1111110111111111111110111110100101001101" ] } ] "disallowZeroCount" : "false", { } "eventActions" : [ if ( key == neededkeys[0] ) { "eventActions" : [ "disallowZeroCount" : "false", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" ] { "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, }, "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "useCountToKudo" : "false", "truncateBody" : "true", ;(function($) { { { "action" : "rerender" } "context" : "envParam:feedbackData", "event" : "MessagesWidgetEditAction", "displaySubject" : "true", { "context" : "", Easily manage your company's mobile or fixed line accounts online 24/7. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2066914 .lia-rating-control-passive', '#form_6'); "kudosLinksDisabled" : "false", }, $(document).keydown(function(e) { "event" : "removeThreadUserEmailSubscription", }, } ', 'ajax'); "context" : "", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { } "action" : "rerender" { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_70ce840563054f_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } ] { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { }, } ] }, { if ( !watching ) { "componentId" : "kudos.widget.button", "event" : "unapproveMessage", ], { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "showCountOnly" : "false", "event" : "editProductMessage", "parameters" : { { $(document).ready(function(){ { ] ], }, { } "actions" : [ Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:quiltName", var key = e.keyCode; { ] "actions" : [ } "event" : "ProductAnswerComment", { { { "actions" : [ } { } { ] { "actions" : [ "actions" : [ "componentId" : "kudos.widget.button", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ ] "}); "event" : "RevokeSolutionAction", "actions" : [ { var clickedDomElement = $(this); { { { { ] "actions" : [ "context" : "", }, { } "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "context" : "envParam:selectedMessage", { LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } }, "event" : "unapproveMessage", }, if ( watching ) { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2067099,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); }, "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetEditAnswerForm", ] "displaySubject" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2066434,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "selector" : "#kudosButtonV2_1", "context" : "", { ] ] { "context" : "", { "action" : "rerender" { ] { } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ }, { { { }, { ] { }, "dialogKey" : "dialogKey" { ] "action" : "rerender" { } "context" : "", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" { "linkDisabled" : "false" ] } }, "context" : "envParam:feedbackData", LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", ] "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" } ] "actions" : [ ] "eventActions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"e1Jz27b8__ndoBK0eoF--_MQU2HzD24-A7L6h8XEkxM. { "context" : "envParam:quiltName", "event" : "removeThreadUserEmailSubscription", ] "event" : "approveMessage", { { "eventActions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/227698","ajaxErrorEventName":"LITHIUM:ajaxError","token":"swTKvpn0YZ0zOGGSG-Qi8cad_NoumBkSCTTwBz7hQwM. "context" : "envParam:quiltName,expandedQuiltName", "event" : "RevokeSolutionAction", { } "event" : "RevokeSolutionAction", Die Alternativen wurden dir ja bereits genannt! "action" : "rerender" "componentId" : "forums.widget.message-view", "event" : "expandMessage", }); "selector" : "#kudosButtonV2_2", "eventActions" : [ { if ( watching ) { "action" : "rerender" "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", ] } "actions" : [ "event" : "ProductMessageEdit", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); ] { } "parameters" : { }); { "event" : "MessagesWidgetEditCommentForm", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "initiatorBinding" : true, { "actions" : [ ] "action" : "rerender" "action" : "rerender" }, "event" : "MessagesWidgetEditAction", { "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "parameters" : { "actions" : [ { { "linkDisabled" : "false" "event" : "QuickReply", "event" : "ProductMessageEdit", "actions" : [ "event" : "AcceptSolutionAction", { var watching = false; }, { "actions" : [ Around the globe, our network reaches 182 countries. "event" : "MessagesWidgetMessageEdit", } { "action" : "rerender" }, { "context" : "lia-deleted-state", ] "kudosable" : "true", "disableLinks" : "false", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "MessagesWidgetEditCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $5 Roaming Travel fearlessly in 80 countries with Vodafone for $5 extra a day. $('.css-menu').removeClass('cssmenu-open') "action" : "rerender" ] "event" : "editProductMessage", } ] "context" : "", "context" : "", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "eventActions" : [ } "event" : "expandMessage", "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" ] } else { }, { "quiltName" : "ForumMessage", "initiatorBinding" : true, "displayStyle" : "horizontal", LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } } Das kann aber jederzeit von Vodafone dann auch auf DS-Lite umgestellt werden und man benötigt dann doch die Option "Feste IP". LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); } "kudosable" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ ] }, }, }, "event" : "MessagesWidgetEditAnswerForm", { "actions" : [ "truncateBodyRetainsHtml" : "false", { "action" : "rerender" }, { "truncateBodyRetainsHtml" : "false", "event" : "expandMessage", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "action" : "rerender" "event" : "ProductAnswerComment", }, "initiatorDataMatcher" : "data-lia-kudos-id" { "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:quiltName", "actions" : [ "componentId" : "forums.widget.message-view", ;(function($) { "event" : "ProductAnswer", }, } } { "action" : "rerender" "actions" : [ { ] { "event" : "addThreadUserEmailSubscription", "parameters" : { } { "context" : "envParam:quiltName,product,contextId,contextUrl", { "useSimpleView" : "false", : telefonok, mobil tarifák, mobilinternet Tovább "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosLinksDisabled" : "false", "parameters" : { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] { }, ] { "truncateBodyRetainsHtml" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "action" : "rerender" }, }, } "event" : "ProductAnswerComment", "action" : "rerender" "context" : "", { "event" : "ProductAnswerComment", ] }, ] { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ ] "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { } "context" : "", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_3", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "actions" : [ "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,expandedQuiltName", { { "quiltName" : "ForumMessage", watching = false; $(document).keydown(function(e) { "event" : "MessagesWidgetEditAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "AcceptSolutionAction", }); watching = false; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "disableLinks" : "false", "event" : "MessagesWidgetEditAnswerForm", ] "selector" : "#messageview", // We're good so far. } }, ] "actions" : [ { { ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" Search query Clear search query Search button. $(document).ready(function(){ "action" : "rerender" "action" : "rerender" ] ] window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1926,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk1kEBBwBxcnABRMXAURWgFZV0FcAlMIFHsMFlIWW1ZAHzFgOhZ2FwNbSWZHVVEOaklNVk8Sa0sHAwIHUwZTGx5ABEUFWFZ9VkcMVwsGVFsDXAILBgpWGkRSUTcRUhZ8VxYISAdKG1kBMlYDUH1VXwAUXBt0DRBCCWFcRFsGZgdeV0BOFQ9WfltQDFoDGwhABFYIRlYWHkddBXtdFkANRlNSWEEAFEobWQE2T0YPEVFWVlNXXAQBTwcFDVcZBlUDBxQLUVVTSVYAAwcBBwQJCgQBUUYZEV9RK1kCXHsGQA1GZkdbQBBYAUpfBw5TEVtUUVwsWBJcQAwHQzBjZ1FeAFAJVxBOQFwHZ1ZHRjMEN0xXEBsVXhdgcX4gdTIZWwZCcTZ6fhRfAEUVWFUHERczfXZmd0VCCUlbAUxeAAgMFH4sey9tEl1AShk="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; function createStorage(option){ "context" : "envParam:selectedMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", // If watching, pay attention to key presses, looking for right sequence. "context" : "", }, "action" : "rerender" } LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }); "context" : "envParam:quiltName,product,contextId,contextUrl", } { { ] "action" : "rerender" { "truncateBodyRetainsHtml" : "false", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233128}); "context" : "", }, { ] "disableLabelLinks" : "false", "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2066914,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", VAT) on our 36-month 6GB plan* Order now and claim free Galaxy Buds Live. resetMenu(); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2067421 .lia-rating-control-passive', '#form_8'); "event" : "addThreadUserEmailSubscription", "revokeMode" : "true", "actions" : [ { CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "componentId" : "kudos.widget.button", ] { "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,expandedQuiltName", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", { }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); } ] }, "revokeMode" : "true", } "event" : "ProductMessageEdit", ] { "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "removeMessageUserEmailSubscription", ] ] { { "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", "event" : "addMessageUserEmailSubscription", "context" : "envParam:entity", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "context" : "", } "context" : "envParam:quiltName", { "action" : "rerender" "actions" : [ { { ] "action" : "rerender" "action" : "addClassName" "actions" : [ $(document).ready(function(){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); "event" : "ProductAnswer", "event" : "addThreadUserEmailSubscription", "action" : "rerender" }); "context" : "envParam:feedbackData", }, ] }, "context" : "", "actions" : [ } } ] }, "context" : "", "disableKudosForAnonUser" : "false", }, "eventActions" : [ LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] "event" : "MessagesWidgetEditAnswerForm", // just for convenience, you need a login anyways... "actions" : [ { "parameters" : { "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "initiatorBinding" : true, { "revokeMode" : "true", { "action" : "rerender" } { { ], { { "actions" : [ "action" : "pulsate" ] ] "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); } "event" : "unapproveMessage", LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); ] { LITHIUM.Dialog.options['-1547142592'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "event" : "expandMessage", "action" : "rerender" } ] "action" : "rerender" { Hutchinson Jupiter Dual Stack Monopoles are typically found in London, the South West and North West of the UK: areas that Vodafone is in control of Beacon in. "actions" : [ { { ] { "context" : "", "actions" : [ "action" : "rerender" }, "context" : "envParam:quiltName", "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2065620,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBodyRetainsHtml" : "false", "action" : "addClassName" "event" : "MessagesWidgetCommentForm", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2065605}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2066914}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2065620}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2065970}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2066434}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2066632}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2066635}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2066914}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2067099}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2067421}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_53","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2494410}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543699}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543691}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543652}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543574}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543553}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543537}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543527}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543517}},{"elementId":"link_65","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543439}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543417}}]);

Pizzeria Mindelstetten Il Ritrovo, Vogel Wie Alarmanlage, Ort An Der Etsch, Italienisches Restaurant Marktoberdorf, Modetrends 2021 Herren, Cafe Mexx Hattingen, Phantasialand Unfall, Winjas,