Bodetal Thale öffnungszeiten, Zuger Eishockeyclub 3 Buchstaben, Sommer Dekoration Für Draußen, Venus Und Vulcanus, мароны грибы как приготовить, Herren Schmuck Mit Fotogravur, Vcds Softwarestand Motorsteuergerät, Art, Spezies 5 Buchstaben, Au Premier Zürich, Euro-schulen Hannover Stellenangebote, Lausitzer Seenland Wohnmobilstellplätze, Ilvermorny Houses Traits, Www Live Webcam Cuxhaven Duhnen, " />

] LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "actions" : [ LITHIUM.Loader.runJsAttached(); ] "action" : "rerender" "actions" : [ } "event" : "ProductAnswerComment", { ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "event" : "addMessageUserEmailSubscription", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); } { { "actions" : [ $(event.data.selector).removeClass('cssmenu-open'); ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, '2n_pvvCz5Vt-fY9LmRXE1pSg4Ln540ZR2IlcsQUAcWc. "action" : "pulsate" }, //}); Wenn Du Dich per WLAN mit Deinem Handy-Nummer in die MeinVodafone-App einloggst, zählt das nicht als Login. ] { // Set start to true only if the first key in the sequence is pressed } "actions" : [ ] "entity" : "1632083", ] "componentId" : "forums.widget.message-view", watching = false; "includeRepliesModerationState" : "false", }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "actions" : [ ] "action" : "rerender" { "parameters" : { }, "event" : "MessagesWidgetEditAnswerForm", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/28352","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ELJmWjVc2yyrJ0oq0o5E6HcLrn1fv5D74D_9q2TG22U. } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "context" : "", ], }, "truncateBody" : "true", } "linkDisabled" : "false" "action" : "addClassName" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1633220,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "kudosable" : "true", return; count++; { ] LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); { { "actions" : [ //} else { { "forceSearchRequestParameterForBlurbBuilder" : "false", ] } ], } }, } "selector" : "#messageview_1", "context" : "envParam:quiltName", "actions" : [ { "actions" : [ { } var watching = false; ] }); }, ] "action" : "rerender" } "event" : "removeMessageUserEmailSubscription", ] }, "context" : "", "event" : "editProductMessage", "context" : "", }, "parameters" : { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "context" : "envParam:quiltName", "event" : "markAsSpamWithoutRedirect", "actions" : [ "actions" : [ "action" : "rerender" { $(document).ready(function(){ ;(function($) { }, } }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); } { "context" : "", //$('#lia-body').addClass('lia-window-scroll'); } }, "action" : "rerender" "context" : "envParam:feedbackData", }, } ;(function($) { "actions" : [ } } } "entity" : "1634202", "parameters" : { "context" : "envParam:selectedMessage", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/28352","ajaxErrorEventName":"LITHIUM:ajaxError","token":"IIxtY3g_TY5k-jR8Itu-t1kWBMFb3-do_ttgskfb5lc. "actions" : [ "actions" : [ { }); "action" : "rerender" { "truncateBody" : "true", "action" : "rerender" "event" : "MessagesWidgetMessageEdit", "context" : "", window.location = "https://forum.vodafone.de/t5/Archiv-Mein-Vodafone-Mein-Kabel/MeinVodafone-kein-Login-m%C3%B6glich/td-p/1628750" + "/page/" + 1; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "addClassName" { resetMenu(); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" lithstudio: [], }, "actions" : [ }, LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); } } "actions" : [ } "displayStyle" : "horizontal", { }, } { }, "useCountToKudo" : "false", { "event" : "approveMessage", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, })(LITHIUM.jQuery); "action" : "pulsate" ] Ich habe sowohl die App als auch direkt über den Browser Probleme mich einzuloggen. { "event" : "ProductAnswerComment", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "linkDisabled" : "false" { } logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" "action" : "pulsate" "event" : "addThreadUserEmailSubscription", { ] "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] "kudosable" : "true", { "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ } "dialogContentCssClass" : "lia-panel-dialog-content", ] { { }, "eventActions" : [ }, "actions" : [ { $(document).ready(function() { "event" : "expandMessage", "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); { })(LITHIUM.jQuery); ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "disableLinks" : "false", "actions" : [ LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "envParam:quiltName", "action" : "rerender" "event" : "unapproveMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1632702,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "componentId" : "kudos.widget.button", { "displaySubject" : "true", { "action" : "rerender" "revokeMode" : "true", if (event.target.matches('.redirect')) { "actions" : [ }, "context" : "envParam:selectedMessage", ] }, "componentId" : "forums.widget.message-view", "disableKudosForAnonUser" : "false", "linkDisabled" : "false" "event" : "removeThreadUserEmailSubscription",

Bodetal Thale öffnungszeiten, Zuger Eishockeyclub 3 Buchstaben, Sommer Dekoration Für Draußen, Venus Und Vulcanus, мароны грибы как приготовить, Herren Schmuck Mit Fotogravur, Vcds Softwarestand Motorsteuergerät, Art, Spezies 5 Buchstaben, Au Premier Zürich, Euro-schulen Hannover Stellenangebote, Lausitzer Seenland Wohnmobilstellplätze, Ilvermorny Houses Traits, Www Live Webcam Cuxhaven Duhnen,