0) ) } ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.ComponentEvents.set({ }, { { "action" : "rerender" if ( Number(val) < 1 ) ] "action" : "rerender" } ;(function($) { { "action" : "rerender" "action" : "rerender" ], { { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", watching = true; "action" : "rerender" }, "kudosLinksDisabled" : "false", return false; "event" : "RevokeSolutionAction", { } }, { "quiltName" : "ForumMessage", "quiltName" : "ForumMessage", "actions" : [ { "actions" : [ return false; "context" : "", { }, "actions" : [ { { "componentId" : "forums.widget.message-view", "; { "actions" : [ { }); "event" : "addThreadUserEmailSubscription", "event" : "RevokeSolutionAction", { ] $(document).ready(function(){ "truncateBodyRetainsHtml" : "false", "event" : "removeThreadUserEmailSubscription", { "action" : "rerender" "actions" : [ { "kudosLinksDisabled" : "false", "context" : "", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "QuickReply", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", { }, } "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", { "disallowZeroCount" : "false", } "entity" : "2228367", "context" : "", }); { } "context" : "envParam:entity", "initiatorDataMatcher" : "data-lia-kudos-id" { ] "context" : "", } "initiatorDataMatcher" : "data-lia-kudos-id" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ }); event.returnValue = false; "event" : "ProductMessageEdit", { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_70c9c339bf8aeb', 'disableAutoComplete', '#ajaxfeedback_70c9c339399659_0', 'LITHIUM:ajaxError', {}, '5TSiRKvN2vPyV04PqsBxZ27ocQc4YpJRRHjar_xI56A. "eventActions" : [ "event" : "editProductMessage", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228895,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "kudosable" : "true", }); "selector" : "#messageview_2", }, "actions" : [ { { }, }, }); "action" : "rerender" { ] "action" : "rerender" count = 0; }, "context" : "", } ] { { { { }, "context" : "", ] { } "context" : "", { "parameters" : { }, LITHIUM.AjaxSupport.ComponentEvents.set({ ], "initiatorDataMatcher" : "data-lia-message-uid" ] "kudosable" : "true", "action" : "rerender" ] }, "initiatorBinding" : true, "kudosable" : "true", "event" : "ProductAnswer", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { "disallowZeroCount" : "false", { "event" : "markAsSpamWithoutRedirect", { }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"E71toRo0qEuhlJHJlupF1KsedR-W4XwQwzDRM6W3ygQ. LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "context" : "envParam:entity", ] "message" : "2228367", "truncateBody" : "true", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_70c9c339399659_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/122274&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", $(this).next().toggle(); } "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); } "actions" : [ "action" : "pulsate" ] { ] "event" : "removeThreadUserEmailSubscription", "displaySubject" : "true", "actions" : [ "context" : "", }, "action" : "pulsate" }, "event" : "unapproveMessage", ] "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); { ] "event" : "MessagesWidgetEditCommentForm", "}); { } { ] "context" : "", "event" : "ProductMessageEdit", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "actions" : [ count = 0; { }, { }, "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "actions" : [ }); "displaySubject" : "true", Senftenberger See Hausboot, Rindfleisch Szechuan Betty Bossi, Restaurant Nordhorn Lieferservice, Semesterplan Wirtschaftspsychologie Master Hbrs, Tierpark Nordhorn Jobs, Saturn Umlaufzeit Um Die Sonne, Wg Gesucht Hamburg Zwischenmiete, Kartoffeln Champignons Paprika, Südsteirische Weinstraße Kitzeck, Peene Fluss Hausboot, " />

{ }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); if ( !watching ) { { "event" : "MessagesWidgetCommentForm", }, "quiltName" : "ForumMessage", } "context" : "", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }); "entity" : "2228895", "actions" : [ "actions" : [ "event" : "expandMessage", "context" : "envParam:selectedMessage", "action" : "rerender" "action" : "rerender" { "actions" : [ }, "useSimpleView" : "false", } "context" : "", }, if ( neededkeys[count] == key ) { } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ $(document).ready(function(){ "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "displayStyle" : "horizontal", "action" : "rerender" ] … { } "event" : "MessagesWidgetMessageEdit", "useTruncatedSubject" : "true", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2232483,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "AcceptSolutionAction", "event" : "MessagesWidgetEditCommentForm", ] "disableKudosForAnonUser" : "false", } ] ] "useCountToKudo" : "false", "disableLabelLinks" : "false", } // We're good so far. { { }, "actions" : [ "actions" : [ "context" : "", "context" : "lia-deleted-state", { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "componentId" : "forums.widget.message-view", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetEditAnswerForm", "context" : "", ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); } ] } }, "context" : "", "event" : "QuickReply", "event" : "RevokeSolutionAction", "actions" : [ "event" : "MessagesWidgetAnswerForm", setWarning(pagerId); $(this).toggleClass("view-btn-open view-btn-close"); "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ Bist du sicher, dass du fortfahren möchtest? "componentId" : "forums.widget.message-view", ] "actions" : [ "actions" : [ "useSubjectIcons" : "true", } }, { LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. setWarning(pagerId); }); } { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "event" : "AcceptSolutionAction", "event" : "unapproveMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", }, "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", { { "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { "context" : "", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" "context" : "envParam:quiltName", watching = false; "action" : "rerender" }, }, o.innerHTML = "Page number must be 1 or greater. "actions" : [ ] "event" : "MessagesWidgetMessageEdit", "event" : "approveMessage", { "action" : "pulsate" Du kannst dies aber auch alles über Dein Kundenportal selbst machen. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "disableLinks" : "false", "actions" : [ "disallowZeroCount" : "false", "linkDisabled" : "false" }, "actions" : [ "actions" : [ "truncateBody" : "true", ] "displaySubject" : "true", { "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", }, var keycodes = { ] "event" : "kudoEntity", }, "context" : "envParam:entity", "action" : "rerender" "entity" : "2228895", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } if ( key == neededkeys[0] ) { "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); if ( watching ) { }, "useSubjectIcons" : "true", "event" : "removeMessageUserEmailSubscription", var count = 0; { "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", "actions" : [ ] "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], "context" : "", resetMenu(); { "action" : "rerender" }, { "action" : "rerender" { }, "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "selector" : "#kudosButtonV2_6", { { ] LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "event" : "addThreadUserEmailSubscription", { "action" : "rerender" { "context" : "", }, { } "kudosLinksDisabled" : "false", lithadmin: [] }, "actions" : [ ] { } { } "event" : "AcceptSolutionAction", } }); }, { }, $(document).ready(function(){ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"YbLlif8auWrWGwATP67yHQXnzoXisw7Pgdmyn_baJmw. { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "eventActions" : [ ;(function($) { } "event" : "deleteMessage", LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "actions" : [ "disableKudosForAnonUser" : "false", } "action" : "rerender" ', 'ajax'); ] "context" : "envParam:quiltName,expandedQuiltName", } "context" : "", ], "action" : "rerender" "action" : "rerender" { ] "context" : "", } "entity" : "2228370", LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" }); { "initiatorDataMatcher" : "data-lia-message-uid" "componentId" : "forums.widget.message-view", { { "context" : "", } "actions" : [ "action" : "rerender" { "action" : "rerender" "useCountToKudo" : "false", { ;(function($) { "event" : "QuickReply", "event" : "ProductAnswerComment", } "context" : "", } { "context" : "", } "actions" : [ "disableKudosForAnonUser" : "false", LITHIUM.Dialog.options['817438950'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "message" : "2233224", } } "context" : "", "disableLinks" : "false", "event" : "RevokeSolutionAction", "action" : "rerender" { { { "defaultAriaLabel" : "", }, }, "context" : "", } ] "actions" : [ "event" : "editProductMessage", "action" : "pulsate" }, "context" : "envParam:quiltName", }, "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); }, { "actions" : [ "action" : "rerender" "context" : "", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); ;(function($) { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228895,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. watching = false; }, }, "context" : "envParam:quiltName", "event" : "unapproveMessage", "action" : "addClassName" "actions" : [ "event" : "MessagesWidgetCommentForm", }, "componentId" : "kudos.widget.button", if (typeof(Storage) !== "undefined") { "action" : "rerender" "actions" : [ "eventActions" : [ "event" : "MessagesWidgetCommentForm", { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228895,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "truncateBodyRetainsHtml" : "false", } "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lk03pmLd-Yz5pIs3VrLN4CbFo4ZQZrKj5dYOWhF0r14. "actions" : [ Drück die Reset-Taste mit dem spitzen Gegenstand ein. "actions" : [ "actions" : [ "event" : "ProductAnswerComment", "event" : "RevokeSolutionAction", "event" : "deleteMessage", "initiatorBinding" : true, { } { } ] "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" }, } else { "context" : "", }, }, }, "actions" : [ "action" : "pulsate" }, ] "event" : "MessagesWidgetEditAction", } "action" : "pulsate" "actions" : [ "action" : "rerender" "action" : "rerender" ] "context" : "", "context" : "", "event" : "markAsSpamWithoutRedirect", } "context" : "", } "actions" : [ if (isNaN(val) ) } }, ] }, "event" : "MessagesWidgetCommentForm", { { "event" : "approveMessage", "includeRepliesModerationState" : "false", ] }(LITHIUM.jQuery)); "context" : "envParam:quiltName,product,contextId,contextUrl", } }, "linkDisabled" : "false" ] "actions" : [ { } } { { return false; "event" : "MessagesWidgetEditCommentForm", "kudosable" : "true", if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") function doChecks(pagerId, val) { "componentId" : "forums.widget.message-view", { LITHIUM.Loader.runJsAttached(); { "event" : "expandMessage", "quiltName" : "ForumMessage", { "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); { lithadmin: [] "initiatorBinding" : true, // We're good so far. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"E71toRo0qEuhlJHJlupF1KsedR-W4XwQwzDRM6W3ygQ. $(this).next().toggle(); "actions" : [ "event" : "MessagesWidgetCommentForm", { ] "selector" : "#messageview_3", "actions" : [ } } "event" : "kudoEntity", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } { }, o.innerHTML = "Page must be an integer number. "context" : "", "eventActions" : [ }); "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); ] { "event" : "addThreadUserEmailSubscription", "actions" : [ } { if (doChecks(pagerId, val)) "linkDisabled" : "false" "componentId" : "kudos.widget.button", // Set start to true only if the first key in the sequence is pressed { "selector" : "#messageview", "actions" : [ if (isNaN(val) ) "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, und da du einen DS Lite Anschluß ohne öffentliche IPv4 hast, ist der Menüpunkt für Portweiterleitungen ausgeblendet. "actions" : [ } "quiltName" : "ForumMessage", { ] "actions" : [ }); if ( neededkeys[count] == key ) { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_70c9c339399659","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_70c9c339399659_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Internet-Endgeraete/thread-id/122274&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RrriMZvTOVhW5XKC1QdObX6JZ6tHQnyocSknJGOK54c. o.innerHTML = ""; { "actions" : [ }, "actions" : [ "context" : "", ] setWarning(pagerId); Unitymedia) bzw. "actions" : [ }, "truncateBodyRetainsHtml" : "false", "action" : "addClassName" "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" "context" : "envParam:quiltName,message", "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { element.find('li').removeClass('active'); "includeRepliesModerationState" : "false", } { { { { }, { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" } "actions" : [ "context" : "envParam:feedbackData", } "context" : "envParam:entity", "activecastFullscreen" : false, "action" : "rerender" { { "context" : "lia-deleted-state", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", }); { "context" : "", { "event" : "addThreadUserEmailSubscription", }, ] "context" : "envParam:entity", { }, "initiatorDataMatcher" : "data-lia-kudos-id" }, { "parameters" : { "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", } "event" : "unapproveMessage", Hallo Forum Nach einem Upgrade auf einen Kabelrouter Vodafone Station habe ich da so meine Probleme mit dem Teil. "event" : "RevokeSolutionAction", } "context" : "envParam:quiltName,expandedQuiltName", //$('#community-menu-toggle').removeClass('active') } "actions" : [ "context" : "", "event" : "removeThreadUserEmailSubscription", { "quiltName" : "ForumMessage", "event" : "deleteMessage", "actions" : [ } { ] { ] "; "context" : "lia-deleted-state", Ja, ich habe die Option "öffentliche IPv4" in meinem Vodafone Kabelvertrag online sichtbar. }, LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "message" : "2232632", "event" : "markAsSpamWithoutRedirect", "disableLinks" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "context" : "", "actions" : [ { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ }, "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ > 0) ) } ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport.ComponentEvents.set({ }, { { "action" : "rerender" if ( Number(val) < 1 ) ] "action" : "rerender" } ;(function($) { { "action" : "rerender" "action" : "rerender" ], { { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", watching = true; "action" : "rerender" }, "kudosLinksDisabled" : "false", return false; "event" : "RevokeSolutionAction", { } }, { "quiltName" : "ForumMessage", "quiltName" : "ForumMessage", "actions" : [ { "actions" : [ return false; "context" : "", { }, "actions" : [ { { "componentId" : "forums.widget.message-view", "; { "actions" : [ { }); "event" : "addThreadUserEmailSubscription", "event" : "RevokeSolutionAction", { ] $(document).ready(function(){ "truncateBodyRetainsHtml" : "false", "event" : "removeThreadUserEmailSubscription", { "action" : "rerender" "actions" : [ { "kudosLinksDisabled" : "false", "context" : "", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "QuickReply", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", { }, } "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", { "disallowZeroCount" : "false", } "entity" : "2228367", "context" : "", }); { } "context" : "envParam:entity", "initiatorDataMatcher" : "data-lia-kudos-id" { ] "context" : "", } "initiatorDataMatcher" : "data-lia-kudos-id" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ }); event.returnValue = false; "event" : "ProductMessageEdit", { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_70c9c339bf8aeb', 'disableAutoComplete', '#ajaxfeedback_70c9c339399659_0', 'LITHIUM:ajaxError', {}, '5TSiRKvN2vPyV04PqsBxZ27ocQc4YpJRRHjar_xI56A. "eventActions" : [ "event" : "editProductMessage", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2228895,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "kudosable" : "true", }); "selector" : "#messageview_2", }, "actions" : [ { { }, }, }); "action" : "rerender" { ] "action" : "rerender" count = 0; }, "context" : "", } ] { { { { }, "context" : "", ] { } "context" : "", { "parameters" : { }, LITHIUM.AjaxSupport.ComponentEvents.set({ ], "initiatorDataMatcher" : "data-lia-message-uid" ] "kudosable" : "true", "action" : "rerender" ] }, "initiatorBinding" : true, "kudosable" : "true", "event" : "ProductAnswer", { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { "disallowZeroCount" : "false", { "event" : "markAsSpamWithoutRedirect", { }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/122274","ajaxErrorEventName":"LITHIUM:ajaxError","token":"E71toRo0qEuhlJHJlupF1KsedR-W4XwQwzDRM6W3ygQ. LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "context" : "envParam:entity", ] "message" : "2228367", "truncateBody" : "true", { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_70c9c339399659_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/122274&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", $(this).next().toggle(); } "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); } "actions" : [ "action" : "pulsate" ] { ] "event" : "removeThreadUserEmailSubscription", "displaySubject" : "true", "actions" : [ "context" : "", }, "action" : "pulsate" }, "event" : "unapproveMessage", ] "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); { ] "event" : "MessagesWidgetEditCommentForm", "}); { } { ] "context" : "", "event" : "ProductMessageEdit", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "actions" : [ count = 0; { }, { }, "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "actions" : [ }); "displaySubject" : "true",

Senftenberger See Hausboot, Rindfleisch Szechuan Betty Bossi, Restaurant Nordhorn Lieferservice, Semesterplan Wirtschaftspsychologie Master Hbrs, Tierpark Nordhorn Jobs, Saturn Umlaufzeit Um Die Sonne, Wg Gesucht Hamburg Zwischenmiete, Kartoffeln Champignons Paprika, Südsteirische Weinstraße Kitzeck, Peene Fluss Hausboot,