Mechanische Verfahrenstechnik Kit, Kein Appetit Vor Nmt, Morgen In Neumarkt, If In For Schleife Java, Mobilheim Am See Pachten, Hannoversche Straße 88 Hamburg, Urlaub In Den Bergen Kärnten, Obermaiselstein Grasgehren Webcam, Restaurants Basel Covid, Wohnung In Maxdorf Kaufen, Outlaw Kita Münster, " />

"action" : "rerender" }, { "event" : "MessagesWidgetEditAction", "action" : "rerender" "action" : "pulsate" "kudosable" : "true", "useTruncatedSubject" : "true", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/164458","ajaxErrorEventName":"LITHIUM:ajaxError","token":"zKkphkRThfA99E1IBXnhoWQpRvPuRUyxdujdMpXOCB0. ] { "context" : "", "initiatorBinding" : true, { "context" : "", "selector" : "#kudosButtonV2_6", "forceSearchRequestParameterForBlurbBuilder" : "false", { } { "context" : "envParam:quiltName,message", "actions" : [ "event" : "ProductMessageEdit", { }, "actions" : [ "context" : "", { { }); "revokeMode" : "true", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "action" : "rerender" ] "initiatorBinding" : true, { { }, ] ] "useSimpleView" : "false", "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "useTruncatedSubject" : "true", "event" : "MessagesWidgetCommentForm", { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.Dialog({ ] "useCountToKudo" : "false", window.location.replace('/t5/user/userloginpage'); ] "actions" : [ "actions" : [ "actions" : [ "truncateBody" : "true", "eventActions" : [ "event" : "unapproveMessage", "actions" : [ }); "displayStyle" : "horizontal", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2124491 .lia-rating-control-passive', '#form_4'); "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2127043 .lia-rating-control-passive', '#form_2'); "action" : "rerender" "action" : "rerender" } ] { $(event.data.selector).addClass('cssmenu-open') } "context" : "", "action" : "rerender" { "action" : "pulsate" '; { { "event" : "MessagesWidgetEditAction", { "disallowZeroCount" : "false", "entity" : "2124999", { "disableLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } "dialogKey" : "dialogKey" "action" : "rerender" }, ] { function disableInput(pagerId) { "context" : "", } "context" : "envParam:quiltName,expandedQuiltName", "disableLinks" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } }, "actions" : [ }); "actions" : [ "event" : "MessagesWidgetCommentForm", }, "actions" : [ "actions" : [ // Oops. "event" : "RevokeSolutionAction", } "actions" : [ "action" : "rerender" }, }, ] return true; { "linkDisabled" : "false" ', 'ajax'); { { } ] }, "actions" : [ "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "componentId" : "kudos.widget.button", { "event" : "QuickReply", ] "useTruncatedSubject" : "true", ] "action" : "rerender" Wenn du eine konkrete sichere Antwort haben willst - bleib bei einem Kontaktkanal - zuviele Köche versalzen die Suppe. "useSimpleView" : "false", "disableLabelLinks" : "false", { "action" : "pulsate" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], } { "revokeMode" : "true", { ] }, } } "parameters" : { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2127043,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { } ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", "event" : "approveMessage", "action" : "rerender" } "messageViewOptions" : "1111110111111111111110111110100101001101" { }, { ] LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "event" : "MessagesWidgetEditAction", } "truncateBodyRetainsHtml" : "false", { "context" : "", "action" : "pulsate" "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2136896,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "quiltName" : "ForumMessage", "action" : "rerender" { "actions" : [ "event" : "removeThreadUserEmailSubscription", } LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", "action" : "rerender" lithadmin: [] "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "AcceptSolutionAction", }, }, "action" : "rerender" { }, "context" : "envParam:quiltName,message", ] return true; "context" : "envParam:quiltName", "event" : "kudoEntity", }); "action" : "rerender" "entity" : "2136901", "context" : "", "actions" : [ { }, "displaySubject" : "true", { { }, "componentId" : "forums.widget.message-view", "action" : "pulsate" } "actions" : [ "action" : "rerender" ] "truncateBody" : "true", }); "context" : "", { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_6", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/123456/thread-id/163746","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lIFbmIAHhycQOkmVTHpaZqAnKZttZMqhvkpaTsQgYmc. } }, "action" : "rerender" "context" : "", "context" : "", "actions" : [ "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { { LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); { } "actions" : [ LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { "disableKudosForAnonUser" : "false", LITHIUM.Loader.runJsAttached(); "initiatorBinding" : true, "actions" : [ "action" : "rerender" "action" : "rerender" "actions" : [ { "action" : "rerender" LITHIUM.Dialog.options['-1680086654'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] { LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; o.innerHTML = "Page number can\'t exceed 2. } }, "action" : "pulsate" }, } "action" : "pulsate" } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { $(event.data.selector).removeClass('cssmenu-open'); } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] } "event" : "removeMessageUserEmailSubscription", "actions" : [ ] "actions" : [ "action" : "rerender" "actions" : [ if ( Number(val) < 1 ) "action" : "rerender" } "displayStyle" : "horizontal", { }, }, }, } "actions" : [ }, o.innerHTML = "Page number must be 1 or greater. // just for convenience, you need a login anyways... "context" : "", "action" : "rerender" $(document).ready(function(){ } } { }, { "context" : "envParam:quiltName", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2423576,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "context" : "", ] ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_9', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:selectedMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useTruncatedSubject" : "true", "context" : "envParam:quiltName,expandedQuiltName", }, "eventActions" : [ { } }, { } }, { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "quiltName" : "ForumMessage", "action" : "rerender" } }, { } else { } "action" : "rerender" "action" : "pulsate" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); ] }, { "event" : "editProductMessage", } { ;(function($) { "event" : "addMessageUserEmailSubscription", "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); } watching = true; ] "context" : "envParam:quiltName,message", }, "disallowZeroCount" : "false", }, "event" : "MessagesWidgetEditCommentForm", ] } } var keycodes = { "truncateBodyRetainsHtml" : "false", "event" : "ProductMessageEdit", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { }, "actions" : [ { { "context" : "lia-deleted-state", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2124370,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } } "context" : "", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, { { "action" : "rerender" "event" : "ProductAnswer", "actions" : [ ] "event" : "MessagesWidgetEditCommentForm", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, } }, LITHIUM.AjaxSupport.ComponentEvents.set({ } } "parameters" : { }, { "}); { } }, }, { ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2124365 .lia-rating-control-passive', '#form_1'); "initiatorBinding" : true, "event" : "editProductMessage", "event" : "ProductAnswer", { }, "showCountOnly" : "false", { { }, }, ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { { "action" : "pulsate" ] }, "useTruncatedSubject" : "true", { }); }, }, Bist du sicher, dass du fortfahren möchtest? "initiatorDataMatcher" : "data-lia-kudos-id" "selector" : "#messageview_6", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "actions" : [ "actions" : [ } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", }, }, "actions" : [ "event" : "markAsSpamWithoutRedirect", "disableKudosForAnonUser" : "false", }, "actions" : [ "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { ] "event" : "kudoEntity", { { } { "floatedBlock" : "acceptedSolutions", ] Bist du sicher, dass du fortfahren möchtest? { { "context" : "", "action" : "rerender" "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "action" : "rerender" "action" : "rerender" }, "actions" : [ "selector" : "#kudosButtonV2_4", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, '5KrKtA8sA9Nh9DfC1sssRg4q3ij_4AjlhYIdcoPz-qE. "actions" : [ } }, { "action" : "rerender" { "}); { "action" : "rerender" "actions" : [ } }, { "action" : "rerender" }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); "parameters" : { { ], /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "editProductMessage", { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { ] "parameters" : { ] "event" : "MessagesWidgetEditAction", ] ], "event" : "MessagesWidgetEditCommentForm", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", // Oops, not the right sequence, lets restart from the top. "action" : "rerender" "context" : "", "displaySubject" : "true", })(LITHIUM.jQuery); ] "event" : "MessagesWidgetCommentForm", } }, { "event" : "MessagesWidgetEditAction", ] ', 'ajax'); { }, ] "context" : "", "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" "disableLabelLinks" : "false", }, }, "includeRepliesModerationState" : "false", } "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }); "actions" : [ // Reset the conditions so that someone can do it all again. { "selector" : "#kudosButtonV2_6", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"});

Mechanische Verfahrenstechnik Kit, Kein Appetit Vor Nmt, Morgen In Neumarkt, If In For Schleife Java, Mobilheim Am See Pachten, Hannoversche Straße 88 Hamburg, Urlaub In Den Bergen Kärnten, Obermaiselstein Grasgehren Webcam, Restaurants Basel Covid, Wohnung In Maxdorf Kaufen, Outlaw Kita Münster,