Uniklinik Regensburg News, Ratscher Landhaus Angebote, Am Wasser Zürich, Job Als Haushaltshilfe Privat, Odeon Bar Zürich, Superbike-wm 2020 Termine, Gewerbliche Ausbildung Wikipedia, Rügen Keramik Onlineshop, Hotel Fiedler Brilon, Hauser Kaibling Mautstraße, " />

"event" : "MessagesWidgetAnswerForm", "eventActions" : [ } $(document).keydown(function(e) { "eventActions" : [ "context" : "envParam:quiltName", ] { "event" : "expandMessage", "event" : "removeMessageUserEmailSubscription", "context" : "", "showCountOnly" : "false", "event" : "MessagesWidgetEditAction", ] })(LITHIUM.jQuery); }, { { } { logmein: [76, 79, 71, 77, 69, 73, 78], { ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "rerender" "accessibility" : false, "context" : "envParam:quiltName,message", "action" : "rerender" } ] } "}); ', 'ajax'); "actions" : [ "action" : "rerender" { { "context" : "envParam:quiltName,product,contextId,contextUrl", ] "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "revokeMode" : "true", "context" : "envParam:selectedMessage", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sL5npHFYZ-njETaScxBsIgY8l4EDeGYSPLc3o8JJxrE. "action" : "addClassName" element.children('ul').slideDown(); ] "componentId" : "kudos.widget.button", }, "event" : "AcceptSolutionAction", { "useSimpleView" : "false", "event" : "MessagesWidgetEditCommentForm", "quiltName" : "ForumMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" function createStorage(option){ }, window.onload = function() { "actions" : [ "context" : "", "action" : "rerender" } "actions" : [ } { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1681439,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "displaySubject" : "true", } else { "useTruncatedSubject" : "true", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); element.siblings('li').find('li').removeClass('active'); "context" : "envParam:quiltName,expandedQuiltName", }, { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1677183,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" "event" : "ProductAnswer", "action" : "rerender" }, element.siblings('li').find('ul').slideUp(); } LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "actions" : [ "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2207316}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2212836}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2212856}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2216057}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2536592}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2526114}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2524555}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519457}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543556}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543442}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543427}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543172}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543154}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542865}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542576}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542333}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2542025}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2541402}}]); Bist du sicher, dass du fortfahren möchtest? })(LITHIUM.jQuery); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" "context" : "", { } "action" : "rerender" "action" : "rerender" "showCountOnly" : "false", "event" : "ProductAnswer", "action" : "rerender" { LITHIUM.AjaxSupport.useTickets = false; "actions" : [ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "eventActions" : [ "context" : "", "event" : "kudoEntity", { { "action" : "pulsate" { { } }, ] { "event" : "ProductAnswer", LITHIUM.Dialog({ } ] "actions" : [ }, "context" : "", "initiatorBinding" : true, "useTruncatedSubject" : "true", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1954,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk10BVlfbVM5GSVYXg4bVklzX1FKSFATV1kWC1gKXFZGRkhYD1paFk9cAVxdGXAQVQ5cXE8UWAoYd1VGAFgQVl4XD1IKGEZaVjkZEl0fEj4YVgcDAwFUAEQVEAQQVglQelAQXwdUDQRbVwdUBAMHBkkUDVpnEQdFLVERDh9UGkRSUTIDUAF7UllXRwxEf10QF1owWkNdUTVXAVwQTkBcB3hcVlsJU0QDEBYQQgEXHxZZBnQJTRBYQFEFWUBREEkUDVpmGkANRgMLDFBUUF8IHwBTAgAYBwALABsHDwsGTwQGAVAGBAZTAA9UAUAbRl5Qel0BUy9dEFhAdAVZX21TRxpEUlEwB0QQYwFlRwBEHxsIQDFyKHBwYBIMUkZ\/YC0vFwlQQEdTAlMVGWUqJ2UhFUdbQgxVSFBWX10XKHx+fWZFCURETw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { }, "selector" : "#kudosButtonV2_2", ], "event" : "unapproveMessage", }, }, "actions" : [ //resetMenu(); watching = false; }, "useCountToKudo" : "false", }, "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "context" : "envParam:quiltName", } } "useSimpleView" : "false", ctaHTML += 'Stell Deine Frage'; "context" : "envParam:quiltName,message", // Oops. "context" : "", "revokeMode" : "true", LITHIUM.Dialog({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "context" : "", { { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234327}); }); }); } "useCountToKudo" : "false", if ( neededkeys[count] == key ) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ }, "actions" : [ "context" : "", $(this).next().toggle(); }, "messageViewOptions" : "1111110111111111111110111110100101011101" "dialogContentCssClass" : "lia-panel-dialog-content", { { "context" : "", } "action" : "rerender" "useSimpleView" : "false", LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { } } "event" : "QuickReply", ] LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1954,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk10BVlfbVM5GSVYXg4bVklzX1FKSFATV1kWC1gKXFZGRkhYD1paFk9cAVxdGXAQVQ5cXE8UWAoYd1VGAFgQVl4XD1IKGEZaVjkZEl0fEj4YVgcDAwFUAEQVEAQQVglQelAQXwdUDQRbVwdUBAMHBkkUDVpnEQdFLVERDh9UGkRSUTIDUAF7UllXRwxEf10QF1owWkNdUTVXAVwQTkBcB3hcVlsJU0QDEBYQQgEXHxZZBnQJTRBYQFEFWUBREEkUDVpmGkANRgMLDFBUUF8IHwBTAgAYBwALABsHDwsGTwQGAVAGBAZTAA9UAUAbRl5Qel0BUy9dEFhAdAVZX21TRxpEUlEwB0QQYwFlRwBEHxsIQDFyKHBwYBIMUkZ\/YC0vFwlQQEdTAlMVGWUqJ2UhFUdbQgxVSFBWX10XKHx+fWZFCURETw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ { }, } "action" : "rerender" { } "componentId" : "kudos.widget.button", "showCountOnly" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676536}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676550}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677183}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1679260}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1679305}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1681439}}]); "event" : "MessagesWidgetEditAction", }, }, } "context" : "envParam:entity", ;(function($) { ] }, "event" : "AcceptSolutionAction", ] "actions" : [ })(LITHIUM.jQuery); { { "action" : "rerender" }, "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "event" : "deleteMessage", }); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/89917","ajaxErrorEventName":"LITHIUM:ajaxError","token":"UFLMFRsrKm8kQfqzH8eoFqJzq-tGj4STqEwIspg9Jkw. }; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "removeThreadUserEmailSubscription", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "action" : "rerender" ;(function($){ "activecastFullscreen" : false, }, } else { "action" : "rerender" Deine Online Aufladung hat nicht geklappt, wenn ich das richtig verstehe? "parameters" : { $('.community-menu').removeClass('active') Execute whatever should happen when entering the right sequence "parameters" : { "action" : "pulsate" { ] "actions" : [ "event" : "approveMessage", "context" : "", }, "quiltName" : "ForumMessage", { { "disallowZeroCount" : "false", "disableLabelLinks" : "false", "action" : "rerender" "event" : "addMessageUserEmailSubscription", { "actions" : [ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "QuickReply", "dialogKey" : "dialogKey" }, sessionStorage.setItem("is_scroll", option); }, }, // just for convenience, you need a login anyways... "actions" : [ } "initiatorBinding" : true, "actions" : [ } "action" : "rerender" "disableKudosForAnonUser" : "false", watching = false; }, "truncateBody" : "true", ;(function($) { { ] { }, } "actions" : [ LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); ] "event" : "ProductAnswer", { "accessibility" : false, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "dialogContentCssClass" : "lia-panel-dialog-content", "event" : "markAsSpamWithoutRedirect", { // Register the click event handler { ] ] "selector" : "#messageview_3", "action" : "pulsate" "action" : "rerender" }); "context" : "", ] "actions" : [ "event" : "RevokeSolutionAction", } "eventActions" : [ der Kontoserver und nicht die Kundenbetreuung. "action" : "rerender" "action" : "rerender" { "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ } Bist du sicher, dass du fortfahren möchtest? }); "action" : "rerender" { ], "event" : "ProductMessageEdit", "actions" : [ Leider wird die beliebte App nicht mehr von allen Smartphones unterstützt. "action" : "rerender" } "context" : "envParam:quiltName,product,contextId,contextUrl", "initiatorBinding" : true, } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(document).keydown(function(e) { { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" "}); "actions" : [ }); ] "displayStyle" : "horizontal", { }, }, "disableLinks" : "false", "event" : "editProductMessage", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); if ( key == neededkeys[0] ) { ] "event" : "AcceptSolutionAction", "selector" : "#kudosButtonV2_4", }, }, "actions" : [ { "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); { "context" : "envParam:feedbackData", ] { "context" : "", "action" : "rerender" "parameters" : { "actions" : [ "}); "context" : "", ] $('#community-menu-toggle').click(function() { "action" : "pulsate" { ] "actions" : [ ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "QuickReply", } { { "action" : "rerender" { LITHIUM.Dialog.options['-914987978'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } }); "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:quiltName,expandedQuiltName", { ] LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_65b5e347fbc1c', 'enableAutoComplete', '#ajaxfeedback_65b5e347fbc1c_0', 'LITHIUM:ajaxError', {}, 'niD-dmqkZx-LDOfqzX379WceD3_EYG_Pjww2mKX9cr0. Von Henning Gajek. { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" }, } } // Reset the conditions so that someone can do it all again. "event" : "AcceptSolutionAction", '; "action" : "rerender" { } "truncateBodyRetainsHtml" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); }, "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetCommentForm", { }, "actions" : [ ] "selector" : "#kudosButtonV2_1", "event" : "RevokeSolutionAction", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1679305 .lia-rating-control-passive', '#form_3'); } { "disableKudosForAnonUser" : "false", ] } } "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).ready(function(){ "context" : "envParam:quiltName", "actions" : [ "parameters" : { ] "event" : "removeMessageUserEmailSubscription", "event" : "kudoEntity", "actions" : [ } "truncateBody" : "true", "actions" : [ Highlights der App: - Überblick: Dein aktuelles Guthaben und Deine übrigen Einheiten siehst Du direkt auf der Startseite. { { "action" : "rerender" LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2216057,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { }, }, "disableLinks" : "false", }); window.location.replace('/t5/user/userloginpage'); ] "initiatorBinding" : true, ] "event" : "removeMessageUserEmailSubscription", { ] } "actions" : [ "useCountToKudo" : "false", Bist du sicher, dass du fortfahren möchtest? ] { "event" : "addThreadUserEmailSubscription", } else { { } ] { "event" : "unapproveMessage", { "event" : "approveMessage", }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"X4TZz_tiqi6aXTfrXUW6v0zl7cf1R8Gw6zwcMAsuPAM. "actions" : [ } "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/89917","ajaxErrorEventName":"LITHIUM:ajaxError","token":"2xbz-5zEm0mGOdqeSv5V7xCsSYI8kBPaH2BENGEJuVg. "action" : "pulsate" //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); }, "event" : "addThreadUserEmailSubscription", "eventActions" : [ } { { Siehe neueste. "event" : "MessagesWidgetEditAnswerForm", }); "action" : "rerender" }, Highlights der App: - Überblick: Dein aktuelles Guthaben und Deine übrigen Einheiten siehst Du direkt auf der Startseite. "displaySubject" : "true", "actions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "disableLabelLinks" : "false", "parameters" : { { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2216057,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", } "context" : "", "action" : "rerender" }, "context" : "envParam:quiltName,product,contextId,contextUrl", "dialogContentCssClass" : "lia-panel-dialog-content", }, Jetzt ist es so, dass ich die Taste/Bottun von meinem Handy bzgl. { "action" : "rerender" "linkDisabled" : "false" "context" : "", }, "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "QuickReply", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { return; } {

Uniklinik Regensburg News, Ratscher Landhaus Angebote, Am Wasser Zürich, Job Als Haushaltshilfe Privat, Odeon Bar Zürich, Superbike-wm 2020 Termine, Gewerbliche Ausbildung Wikipedia, Rügen Keramik Onlineshop, Hotel Fiedler Brilon, Hauser Kaibling Mautstraße,